Recombinant Burkholderia multivorans NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If a specific tag type is required, please inform us for preferential development.
Synonyms
nuoA; Bmul_1028; BMULJ_02235; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-119
Protein Length
full length protein
Species
Burkholderia multivorans (strain ATCC 17616 / 249)
Target Names
nuoA
Target Protein Sequence
MNLAAYYPVLLFLLVGTGLGIALVSIGKLLGPNKPDVEKNAPYECGFEAFEDARMKFDVR YYLVAILFIIFDLETAFLFPWGVALRDIGWPGFIAMMIFLLEFLLGFAYIWKKGGLDWE
Uniprot No.

Target Background

Function

NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediaries. In this organism, ubiquinone is the presumed immediate electron acceptor. This redox reaction is coupled with proton translocation, resulting in four hydrogen ions translocated across the cytoplasmic membrane for every two electrons transferred. This process conserves redox energy as a proton gradient.

Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Burkholderia multivorans and why is it significant for research?

Burkholderia multivorans is a rod-shaped, gram-negative bacterium belonging to the Burkholderia cepacia complex (BCC). It has emerged as an opportunistic pathogen in patients with cystic fibrosis (CF) and immunocompromised individuals, capable of causing life-threatening infections . B. multivorans is particularly significant for research because:

  • It is one of the predominant BCC species infecting the lungs of CF patients

  • It causes chronic respiratory infections that are difficult to eradicate

  • Despite infection control measures to reduce BCC spread, B. multivorans infections continue to emerge

  • It can be found in soil, water, and industrial environments, suggesting environmental acquisition

  • It demonstrates genomic adaptability during chronic infection in the CF lung

Understanding B. multivorans pathogenesis mechanisms, including its respiratory components like nuoA, is crucial for developing effective therapeutic strategies against these challenging infections.

What is NADH-quinone oxidoreductase and what role does subunit A (nuoA) play?

NADH-quinone oxidoreductase, also known as Complex I, is a multisubunit enzyme that serves as an entry point to the electron transport chain in bacteria and eukaryotic mitochondria . This enzyme:

  • Catalyzes the electron transfer from NADH to quinone through a chain of iron-sulfur clusters

  • Is composed of 14 core (conserved) subunits in bacteria, including nuoA through nuoN

  • Contains both peripheral and membrane domains, with the peripheral domain catalyzing electron transfer and the membrane domain facilitating proton translocation

Specifically, nuoA (NADH-quinone oxidoreductase subunit A):

  • Is part of the membrane domain of Complex I

  • Is encoded by the nuoA gene, typically found in a co-localized operon with other nuo genes

  • Contains approximately 119 amino acids in Burkholderia species

  • Plays a role in the structural integrity and function of the membrane domain

  • Contains transmembrane helices that form part of the proton translocation machinery

The precise function of nuoA is still being investigated, but its conservation across bacterial species suggests its essential role in respiratory metabolism.

How does B. multivorans NADH-quinone oxidoreductase compare to similar enzymes in other bacterial species?

The NADH-quinone oxidoreductase in B. multivorans shares similarities with homologous enzymes in other bacterial species but also exhibits distinctive features:

Similarities:

  • Contains the 14 core subunits (NuoA to NuoN) found in most bacterial Complex I enzymes

  • Functions in the respiratory electron transport chain

  • The genes are typically arranged in an operonic structure

Differences:

  • Phylogenetic analysis of concatenated Complex I subunits reveals five main clades (A-E)

  • Different bacterial Complex I enzymes can have varying subunit lengths, particularly in NuoE and NuoG

  • Some bacterial species have fused NuoC and NuoD subunits, though this feature is predominantly found in clade E enzymes

While the search results don't provide specific comparative data for B. multivorans nuoA, research on Complex I phylogeny indicates that these enzymes likely evolved with their host organisms, with limited evidence of horizontal gene transfer between different bacterial groups .

What are the recommended methods for cloning and expressing recombinant B. multivorans nuoA?

Based on approaches used for similar proteins, the following methodology is recommended for cloning and expressing recombinant B. multivorans nuoA:

Gene Cloning:

  • Design primers targeting the B. multivorans nuoA gene with appropriate restriction sites

  • Amplify the gene using high-fidelity PCR from genomic DNA

  • Clone the amplified gene into an expression vector with an inducible promoter (such as PBAD)

  • For purification purposes, consider adding a C-terminal 6xHis-tag as demonstrated for other respiratory proteins

Expression System:

  • For homologous expression: Use a B. multivorans host strain with the genomic copy of the target gene deleted

  • For heterologous expression: E. coli is commonly used, but successful expression of Burkholderia proteins often requires optimization

Expression Protocol:

  • Transform the expression vector into the selected host strain

  • Grow transformants in appropriate media (LB or minimal media) with required antibiotics

  • Induce expression at mid-log phase using L-arabinose (for PBAD promoter)

  • Optimize induction conditions (temperature, inducer concentration, duration)

  • Harvest cells and extract membrane proteins using detergents (dodecyl maltoside has been successful for other respiratory proteins)

Purification Strategy:

  • Solubilize membrane fractions with appropriate detergents

  • Perform affinity chromatography using Ni-NTA for His-tagged proteins

  • Consider additional purification steps (ion exchange, size exclusion)

  • Verify protein identity using mass spectrometry

This approach is based on successful strategies used for related proteins, though specific optimization for B. multivorans nuoA may be necessary.

How can researchers verify the functional activity of recombinant nuoA in experimental systems?

Verifying the functional activity of recombinant nuoA presents challenges because nuoA is just one subunit of the multisubunit Complex I. The following approaches can be used to assess functionality:

Complementation Studies:

  • Create a nuoA deletion mutant in B. multivorans using CRISPR/Cas9-based genome editing

  • Characterize the phenotype of the deletion mutant (growth rates, NADH oxidation capacity)

  • Complement the mutant with the recombinant nuoA gene

  • Restoration of wild-type phenotype indicates functional activity

Membrane Integration Assessment:

  • Use fluorescent protein fusions (e.g., GFP) to verify correct cellular localization

  • Perform subcellular fractionation to confirm membrane association

  • Use protease protection assays to determine proper topology

Complex I Assembly Analysis:

  • Use Blue Native PAGE to analyze intact Complex I assembly

  • Compare protein complexes between wild-type, nuoA deletion, and complemented strains

  • Western blotting with antibodies against other Complex I subunits can assess co-assembly

Functional Assays:

  • Measure NADH oxidation rates in membrane preparations (720 electrons per second has been reported for Na+-NQR from V. cholerae)

  • Assess sensitivity to Complex I inhibitors (rotenone, pyridaben)

  • Determine proton pumping activity using pH-sensitive fluorescent dyes or proteoliposome assays

  • Monitor electron transfer through Fe-S clusters using EPR spectroscopy

When interpreting results, remember that the absence of functional complementation might not necessarily indicate that the recombinant protein itself is inactive, but could reflect issues with integration into the full Complex I structure.

What genome editing approaches are most effective for studying nuoA in B. multivorans?

Recent advances in genome editing technologies have significantly improved our ability to manipulate the B. multivorans genome for studying genes like nuoA:

CRISPR/Cas9-Based System:
A modified two-plasmid CRISPR/Cas9 system has been developed specifically for B. multivorans :

  • Components:

    • pCasPA plasmid: Expresses Cas9 endonuclease and λ-Red system proteins (Exo, Gam, Bet)

    • pACRISPR plasmid: Expresses sgRNA and carries the homology-directed repair (HDR) template

  • Protocol Overview:

    • Design a 20-nucleotide spacer targeting nuoA

    • Create repair arms (0.6-0.8 kb each) flanking nuoA

    • Clone these components into pACRISPR

    • Transform both plasmids into B. multivorans

    • Induce with L-arabinose to express Cas9 and λ-Red proteins

    • Select transformants and verify editing

    • Remove plasmids using sacB-based counterselection or growth at 18-20°C with serial passages

  • Advantages:

    • Enables precise, unmarked gene deletions in a single step

    • Allows targeted gene insertions (e.g., reporter genes like GFP)

    • Higher efficiency than traditional allelic exchange methods

    • Works in multiple B. multivorans strains (ATCC 17616, P0213-1, BM1)

    • Has been successfully applied to delete multiple genes (rpfR, bceF, cepR, bcsB)

Traditional Allelic Exchange:
This method is still relevant but more time-consuming:

  • Create a construct with upstream and downstream homology regions

  • Introduce into B. multivorans to form merodiploids

  • Resolve merodiploids through a second homologous recombination event

  • Screen for gene deletion using PCR or phenotypic assays

The CRISPR/Cas9 approach has demonstrated superior efficiency for B. multivorans genome editing and is recommended for nuoA studies.

What structural features of nuoA are essential for its function and how do mutations affect its activity?

While specific structural studies of B. multivorans nuoA are not available in the search results, information can be extrapolated from related systems:

Key Structural Features:

  • Transmembrane helices: Typically 3 transmembrane segments in bacterial nuoA proteins

  • Conserved residues: Several charged and polar residues in the transmembrane regions

  • Protein-protein interaction motifs: For association with other Complex I subunits

  • Loop regions: May participate in conformational changes during the catalytic cycle

Potential Critical Mutations:
Based on studies of other respiratory complexes, several types of mutations might affect nuoA function:

  • Transmembrane Helix Disruptions:

    • Mutations affecting hydrophobic residues in transmembrane regions

    • Proline or glycine substitutions that disrupt helix structure

    • Charged residue insertions in transmembrane domains

  • Interface Residue Alterations:

    • Mutations at subunit interaction surfaces

    • Changes to residues involved in quinone binding

  • Proton Channel Modifications:

    • Mutations of residues contributing to proton translocation

    • Alterations to polar or charged residues in key positions

Studies on electron transfer in the NuoI (TYKY) subunit of E. coli NDH-1 have shown that mutations to cysteine residues coordinating iron-sulfur clusters significantly impact Complex I structure and function . Similar critical residues likely exist in nuoA, though they would serve different functions given nuoA's location in the membrane domain.

Experimental approaches using site-directed mutagenesis coupled with the CRISPR/Cas9 system described for B. multivorans would be valuable for systematic analysis of nuoA structure-function relationships .

How does the evolution of nuoA in chronic B. multivorans infections relate to adaptation in the CF lung environment?

B. multivorans demonstrates ongoing evolution during chronic colonization of CF lungs, with potentially significant implications for nuoA and respiratory function:

Evolutionary Patterns in Chronic Infection:

  • B. multivorans accumulates approximately 2.7 SNPs/year during chronic infection

  • Different lineages show variable mutation rates; some sub-populations mutate at almost double the rate of others (5.3 vs. 2.7 SNPs/year)

  • Mutations in DNA repair mechanisms contribute to hypermutable phenotypes

  • Antibiotic selective pressure influences the evolution trajectory

Potential Adaptations in Respiratory Genes:
While nuoA-specific adaptations aren't detailed in the search results, respiratory adaptation might include:

  • Metabolic Shifting:

    • Mutations affecting the efficiency of electron transport

    • Adaptations to microaerobic conditions in CF mucus

    • Shifts in energy production pathways

  • Resistance Mechanisms:

    • Alterations that reduce ROS production by the respiratory chain

    • Changes that accommodate membrane structure modifications in response to antibiotics

  • Host Interaction:

    • Modifications that reduce inflammatory responses to bacterial components

    • Adaptations to the unique nutrient environment of CF lungs

Research Approaches:
To study nuoA evolution specifically:

  • Perform longitudinal genomic sequencing of B. multivorans isolates from CF patients

  • Compare nuoA sequences between early and late infection isolates

  • Conduct functional studies of evolved variants using the CRISPR/Cas9 system

  • Analyze selective pressures on respiratory genes during antibiotic treatment

This research would provide insights into how respiratory adaptations contribute to B. multivorans persistence in the challenging CF lung environment.

How might understanding nuoA function inform therapeutic strategies against B. multivorans infections?

Research into B. multivorans nuoA and Complex I could inform novel therapeutic approaches for treating these challenging infections:

Potential Therapeutic Strategies:

  • Complex I Inhibitors:

    • Targeted inhibitors of bacterial Complex I could disrupt energy metabolism

    • Differential targeting of bacterial vs. human Complex I is crucial

    • Research with rotenone and pyridaben has demonstrated the vulnerability of Complex I to inhibition

  • Alternate Respiratory Pathways:

    • When Complex I is inhibited, some organisms can express alternative single-subunit NADH dehydrogenases

    • Understanding if B. multivorans possesses such alternatives is important

    • Expression of yeast Ndi1 protein has been shown to bypass Complex I inhibition in other systems

  • Anti-virulence Approaches:

    • If respiratory adaptation contributes to virulence, targeting these adaptations could reduce pathogenicity

    • Compounds that don't kill bacteria but reduce fitness in the host might face less selective pressure

  • Combination Therapies:

    • Targeting respiratory function alongside other pathways might enhance existing antibiotics

    • Understanding metabolic dependencies could reveal synergistic drug combinations

Clinical Considerations:

  • B. multivorans infections in CF patients are notoriously difficult to eradicate

  • For meningitis caused by B. multivorans, trimethoprim/sulfamethoxazole has been effective

  • Any therapeutic targeting respiratory function must consider the complex environment of CF lungs

This research area highlights the importance of basic research into bacterial physiology for informing new therapeutic approaches against antibiotic-resistant pathogens.

What is the relationship between nuoA function and B. multivorans virulence or persistence in host environments?

The relationship between respiratory function (including nuoA) and bacterial virulence is complex and not fully characterized in B. multivorans, but several connections can be hypothesized:

Energy Provision for Virulence:

  • Efficient respiratory metabolism provides ATP for various virulence mechanisms

  • Exotoxin production and secretion systems require significant energy

  • Motility and biofilm formation depend on adequate energy supply

Adaptation to Host Environments:

  • CF lungs present oxygen-limited, nutrient-rich environments

  • Metabolic flexibility, potentially involving respiratory chain modifications, would be advantageous

  • B. multivorans shows evidence of adaptive evolution during chronic infection

Resistance to Host Defense Mechanisms:

  • Respiratory chain function can influence bacterial responses to oxidative stress

  • Complex I can be both a source and target of reactive oxygen species

  • Adaptation of respiratory components may help evade host immune responses

Biofilm Formation:

  • Recent research has targeted several genes in B. multivorans using CRISPR/Cas9, including rpfR, bceF, and bcsB

  • These genes are involved in biofilm formation and virulence regulation

  • The relationship between respiratory function and biofilm metabolism represents an intriguing area for investigation

Research Approaches:

  • Create nuoA deletion or modification mutants using CRISPR/Cas9

  • Assess virulence in appropriate models (G. mellonella or mouse models)

  • Examine biofilm formation capacity with respiratory chain modifications

  • Investigate persistence under antibiotic pressure

Understanding these relationships could reveal new approaches to combat B. multivorans infections by targeting metabolic dependencies rather than using traditional antibiotics.

How do genomic and proteomic variations in nuoA across clinical B. multivorans isolates correlate with patient outcomes?

Understanding the relationship between nuoA variations and clinical outcomes represents an advanced research question requiring integration of genomic, proteomic, and clinical data:

Current Knowledge:

  • B. multivorans shows significant genomic evolution during chronic infection

  • Different sequence types (STs) of B. multivorans have been associated with varying degrees of transmissibility and virulence

  • Globally distributed lineages (e.g., ST-21, ST-375) have been identified in both clinical and environmental isolates

  • Genomic adaptations in chronic infection accumulate at variable rates (2.7-5.3 SNPs/year)

Research Approaches to Address This Question:

  • Genomic Analysis:

    • Sequence nuoA and the complete nuo operon from clinical isolates

    • Identify single nucleotide polymorphisms and structural variations

    • Compare with reference strains and environmental isolates

    • Correlate with patient metadata (disease severity, lung function, treatment response)

  • Functional Characterization:

    • Express variant proteins and assess Complex I activity

    • Use CRISPR/Cas9 to introduce specific variations into reference strains

    • Test growth under various stress conditions relevant to the CF lung

  • Clinical Correlation:

    • Track patient outcomes longitudinally alongside bacterial evolution

    • Assess whether specific nuoA variants correlate with:

      • Disease progression rates

      • Response to antibiotic treatment

      • Inflammatory markers

  • Multi-omics Integration:

    • Combine genomic, transcriptomic, and proteomic data

    • Assess how nuoA variations affect expression patterns of other genes

    • Identify compensatory mechanisms that may influence outcomes

This type of research would require collaborative efforts between microbiologists, clinicians, and bioinformaticians, with careful consideration of patient privacy and ethical implications.

What are the major challenges in producing and purifying functional recombinant nuoA for structural studies?

Producing and purifying nuoA presents several technical challenges that researchers should anticipate:

Expression Challenges:

  • Membrane Protein Expression:

    • NuoA is an integral membrane protein with multiple transmembrane segments

    • Overexpression often leads to misfolding, aggregation, or toxicity

    • Inclusion bodies formation is common with membrane proteins

  • Host Selection:

    • E. coli may not properly process Burkholderia proteins

    • Homologous expression in B. multivorans requires genetic tools and biosafety considerations

    • The use of B. multivorans with deleted genomic nuoA might be necessary for complementation studies

  • Expression Conditions:

    • Induction conditions (temperature, inducer concentration) need careful optimization

    • Reduced expression rates often improve proper membrane insertion

    • Co-expression with chaperones may improve folding

Purification Challenges:

  • Detergent Selection:

    • Critical for extracting membrane proteins while maintaining native conformation

    • Different detergents yield varying protein quality (e.g., dodecyl maltoside vs. LDAO)

    • Detergent choice affects co-purification of lipids and other components

  • Complex Stability:

    • NuoA normally exists as part of a multisubunit complex

    • Isolation may destabilize the protein structure

    • Consider purifying larger subcomplexes rather than individual subunits

  • Functional Assessment:

    • Isolated nuoA may not display measurable activity outside its native complex

    • Reconstitution into proteoliposomes might be necessary

    • Structural integrity verification is essential (circular dichroism, thermal stability assays)

Solutions and Approaches:

  • Use fusion partners that enhance membrane targeting and solubility

  • Consider nanodiscs or other membrane mimetics for stabilization

  • Employ mild solubilization conditions and rapid purification protocols

  • Verify protein identity using mass spectrometry techniques

  • Consider co-expression strategies if individual subunit expression fails

These technical challenges explain why structural studies of complete bacterial Complex I have been limited, with most insights coming from larger model systems.

What are the best approaches for studying interactions between nuoA and other Complex I subunits?

Investigating protein-protein interactions within Complex I requires specialized techniques adapted for membrane proteins:

Genetic Approaches:

  • Synthetic Lethality:

    • Generate conditional mutants of interacting subunits

    • Assess genetic interactions through growth phenotypes

    • Use the CRISPR/Cas9 system developed for B. multivorans for precise genetic manipulation

  • Suppressor Mutation Analysis:

    • Identify second-site suppressors that restore function to nuoA mutants

    • Map these to potential interaction partners

    • Verify interactions through targeted mutagenesis

Biochemical Methods:

  • Crosslinking Studies:

    • Use chemical or photo-crosslinkers to capture transient interactions

    • Identify crosslinked partners through mass spectrometry

    • Site-specific crosslinkers can map interaction interfaces

  • Co-purification Approaches:

    • Tagged nuoA can pull down interaction partners

    • Sequential purification with differently tagged subunits can identify subcomplexes

    • Quantitative proteomics can assess interaction strength

Structural Biology Techniques:

  • Cryo-electron Microscopy:

    • Suitable for large membrane protein complexes

    • Can reveal the architectural organization of the complete Complex I

    • Requires purification of intact complexes in sufficient quantities

  • Förster Resonance Energy Transfer (FRET):

    • Label suspected interaction partners with fluorophore pairs

    • Measure energy transfer as an indicator of proximity

    • Can be performed in native membrane environments

  • Hydrogen-Deuterium Exchange Mass Spectrometry:

    • Identifies protected regions that may represent interaction interfaces

    • Compatible with membrane proteins when appropriate detergents are used

    • Provides dynamic information about conformational changes

Computational Approaches:

  • Molecular dynamics simulations of subunit interactions

  • Coevolution analysis to identify co-varying residues between subunits

  • Homology modeling based on related bacterial Complex I structures

These approaches can be combined to build a comprehensive understanding of nuoA's interactions within the B. multivorans Complex I architecture.

How can researchers effectively model the structure and function of B. multivorans nuoA when crystallographic data is unavailable?

In the absence of direct crystallographic data, several complementary approaches can be used to model B. multivorans nuoA structure and function:

Homology Modeling:

  • Template Selection:

    • Identify homologous subunits from structurally characterized bacterial Complex I

    • Recent cryo-EM structures from E. coli and Thermus thermophilus provide excellent templates

    • Assess sequence identity/similarity to evaluate model quality expectations

  • Model Building:

    • Use specialized tools for membrane protein modeling (e.g., MODELLER with membrane-specific scoring functions)

    • Pay special attention to transmembrane helix predictions

    • Refine models using molecular dynamics with membrane mimetics

  • Model Validation:

    • Assess stereochemical quality using tools like PROCHECK

    • Validate transmembrane topology predictions with experimental data

    • Cross-validate with evolutionary conservation data

Integrative Structural Biology:

Molecular Dynamics Simulations:

  • Embed modeled structures in appropriate lipid bilayers

  • Simulate behavior in membrane environments

  • Assess stability and conformational changes

  • Model potential proton translocation pathways

Integration with Experimental Data:

  • Use the CRISPR/Cas9 system for B. multivorans to generate targeted mutations for model validation

  • Express variants with reporter tags to assess membrane topology

  • Correlate structural predictions with functional measurements

This integrated approach can provide valuable insights even without crystallographic data and generate testable hypotheses about nuoA structure and function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.