Recombinant Burkholderia multivorans NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Production and Purification

nuoK is synthesized in E. coli as a recombinant protein with an N-terminal His-tag to facilitate purification via affinity chromatography. Key production specifications include:

ParameterDetail
GenenuoK (UniProt ID: A9AFZ7)
Protein LengthFull-length (1–101 amino acids)
TagN-terminal His-tag
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS-based buffer with 6% trehalose, pH 8.0
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL); 50% glycerol recommended for storage

The protein is lyophilized and stored at -20°C/-80°C to maintain stability, with working aliquots kept at 4°C for up to one week .

Role in Complex I

Complex I is an L-shaped enzyme with a hydrophilic matrix-facing arm and a hydrophobic membrane arm. nuoK belongs to the membrane arm, where it contributes to proton translocation and quinone reduction. The enzyme’s function involves:

  • NADH oxidation: Catalyzed by the hydrophilic domain.

  • Electron transfer: Mediated by iron-sulfur clusters.

  • Proton pumping: Driven by the membrane domain, including nuoK .

Research Applications

nuoK is utilized in diverse studies, including:

Bioenergetic Research

  • Electron transport analysis: Investigating proton-pumping mechanisms in complex I.

  • Subunit interactions: Mapping interactions between nuoK and other complex I subunits (e.g., nuoL, nuoM) .

Diagnostic and Biotechnological Tools

  • ELISA assays: Recombinant nuoK is used in enzyme-linked immunosorbent assays to detect antibodies against B. multivorans in clinical or environmental samples .

Pathogenicity Studies

  • Burkholderia pathogenesis: nuoK’s role in energy metabolism may impact bacterial survival in host environments.

Table 2: Amino Acid Sequence Highlights

PositionSequence SegmentKey Features
1–20MLTLAHYLVLGAILFAIAIVGIFLNRRHydrophobic N-terminus; membrane integration
50–70GDVHGQ IFVFFVLTVAAAEAAIGLAILConserved motifs for quinone interaction
90–101TLFRKLDTINVEDLDQLKGProton channel stabilization

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will accommodate your request as best as possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery estimates, please contact your local distributors.
Note: All of our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate this with us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, briefly centrifuge the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1 and 1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and serves as a reference point for customers.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein. Generally, the shelf life for liquid form is 6 months at -20°C/-80°C, while lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
nuoK; Bmul_1038; BMULJ_02225; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Burkholderia multivorans (strain ATCC 17616 / 249)
Target Names
nuoK
Target Protein Sequence
MLTLAHYLVLGAILFAIAIVGIFLNRRNIIIILMAIELMLLAVNTNFVAFSHYLGDVHGQ IFVFFVLTVAAAEAAIGLAILVTLFRKLDTINVEDLDQLKG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH to quinones in the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediates. In this particular species, the enzyme's immediate electron acceptor is believed to be ubiquinone. This process couples the redox reaction to proton translocation, where four hydrogen ions are translocated across the cytoplasmic membrane for every two electrons transferred. This mechanism effectively conserves the redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the genetic context of nuoK in B. multivorans and how does it compare to other BCC species?

The nuoK gene in B. multivorans encodes subunit K of the NADH-quinone oxidoreductase (Complex I), a crucial component of the electron transport chain. This gene is typically located within the nuo operon containing 13-14 genes encoding the various subunits of Complex I. Comparative genomic analysis shows that the nuoK gene is highly conserved among Burkholderia species, including B. cenocepacia, though with some sequence variations that might reflect adaptation to different niches.

When investigating nuoK, researchers should perform comparative sequence analysis using genome sequences available from references like B. multivorans ATCC 17616 and ATCC_BAA-247, as these strains have been used for genome annotation and comparison studies . Multi-locus sequence typing (MLST) can be useful for contextualizing the genetic background of the strain being studied, as B. multivorans shows considerable genetic diversity with at least 64 sequence types identified globally .

What expression systems are most effective for producing recombinant B. multivorans nuoK protein?

  • Vector selection: pET-based vectors with T7 promoters offer high-level expression, though toxicity can be an issue with membrane proteins like nuoK.

  • Host strains: C41(DE3) or C43(DE3) E. coli strains are recommended as they are designed for toxic membrane protein expression.

  • Induction conditions: Lower temperatures (16-18°C) and reduced IPTG concentrations (0.1-0.5 mM) usually result in better folding of membrane proteins.

  • Fusion tags: A combination of His-tag for purification and fusion partners like MBP or SUMO can improve solubility.

Expression should be validated using Western blotting with antibodies against the fusion tag or nuoK protein itself. Researchers should be aware that successful expression may require optimization based on the specific sequence characteristics of B. multivorans nuoK, as membrane proteins often require strain-specific protocols.

What are the standard purification techniques for recombinant nuoK protein?

Purification of recombinant nuoK protein presents significant challenges due to its hydrophobic nature as a membrane protein. A methodological approach should include:

  • Membrane fraction isolation: Differential centrifugation to separate cell membranes following cell lysis.

  • Solubilization: Careful selection of detergents is critical, with n-dodecyl-β-D-maltoside (DDM) or digitonin being good starting options.

  • Purification steps:

    • Immobilized metal affinity chromatography (IMAC) for initial capture

    • Size exclusion chromatography for removing aggregates and improving purity

    • Ion exchange chromatography as a polishing step if needed

Researchers should monitor protein quality at each step using SDS-PAGE and Western blotting. Mass spectrometry can confirm protein identity and detect any post-translational modifications. It's worth noting that the oxidative stress encountered by B. multivorans in CF lungs might induce modifications to nuoK , so purification conditions should minimize oxidation by including reducing agents.

How might mutations in nuoK affect B. multivorans adaptation during chronic CF infection?

Mutations in respiratory chain components like nuoK could significantly impact B. multivorans adaptation during chronic infection. Based on genomic studies of chronic BCC infections, several methodological approaches can address this question:

  • Longitudinal sequencing: Analyze nuoK sequences from serial isolates collected over the course of chronic infection. The mutation accumulation rate for B. multivorans has been reported as approximately 2.27 SNPs/year in chronic CF infections .

  • Functional characterization: Engineer isogenic mutants with clinically observed nuoK mutations using site-directed mutagenesis and assess:

    • Growth rates under aerobic, microaerobic, and anaerobic conditions

    • Resistance to oxidative stress (relevant to CF lung environment)

    • Biofilm formation capacity

    • Antibiotic susceptibility profiles

  • Transcriptomic analysis: Compare gene expression profiles between wild-type and nuoK mutants to identify compensatory pathways activated when Complex I function is compromised.

Research has shown that B. multivorans undergoes significant adaptive evolution during chronic infection, acquiring mutations in multiple genes related to metabolism and stress response . While specific nuoK mutations weren't directly reported in the available literature, the respiratory chain represents a likely target for adaptation to the low-oxygen CF lung environment.

What role might nuoK play in the transition metal metabolism adaptations observed in B. multivorans during CF infection?

Transition metal metabolism has emerged as a hotspot for nucleotide polymorphism in chronic BCC infections . nuoK's potential role in this adaptation can be investigated through:

  • Metal binding analysis: Recombinant nuoK protein can be analyzed for metal binding using techniques such as:

    • Inductively coupled plasma mass spectrometry (ICP-MS)

    • Isothermal titration calorimetry (ITC)

    • X-ray absorption spectroscopy

  • Growth assays under metal restriction: Compare growth of wild-type and nuoK mutant B. multivorans under conditions of iron, copper, or zinc limitation, which mimic CF lung environments.

  • Protein-protein interaction studies: Investigate whether nuoK interacts with metal transport proteins using techniques like:

    • Bacterial two-hybrid assays

    • Co-immunoprecipitation

    • Cross-linking mass spectrometry

The research by Nunvar et al. (2017) highlighted that genes related to transition metal metabolism are hotspots for nucleotide polymorphism in chronic BCC infections . Given that respiratory chain complexes often contain iron-sulfur clusters and other metal cofactors, nuoK may be involved in these adaptive processes, potentially affecting electron transport efficiency under the metal-restricted conditions of CF lungs.

How does oxidative stress in the CF lung environment influence nuoK expression and function?

The CF lung environment is characterized by high levels of oxidative stress , which could significantly impact nuoK. To investigate this relationship, researchers should consider:

  • Expression analysis:

    • qRT-PCR to measure nuoK transcript levels under varying oxidative stress conditions

    • Western blotting to assess protein levels

    • Reporter fusions (e.g., nuoK promoter-GFP) to monitor expression in real time

  • Oxidative damage assessment:

    • Protein carbonylation assays to measure oxidative damage to nuoK

    • Mass spectrometry to identify specific oxidation-sensitive residues

    • Functional assays to determine how oxidation affects NADH dehydrogenase activity

  • Redox proteomics approach:

    • Use techniques like OxICAT or redox DIGE to assess the redox state of cysteine residues in nuoK under different oxidative conditions

Research on B. cenocepacia and B. multivorans has revealed that genes associated with oxidative stress response are frequently mutated during chronic infection . A two-component regulatory sensor kinase protein required for sensing and adapting to oxidative stresses was found to be under strong selection pressure in both species, suggesting that respiratory chain components like nuoK might undergo similar adaptation.

What are effective approaches for studying nuoK function in the context of B. multivorans virulence?

To investigate the relationship between nuoK function and B. multivorans virulence, researchers should consider the following methodological approaches:

  • Genetic manipulation strategies:

    • Construction of nuoK deletion mutants using allelic exchange

    • Complementation studies with wild-type and mutant nuoK alleles

    • CRISPR-Cas9 techniques for precise genome editing

  • Virulence assays:

    • Cell culture models using CF bronchial epithelial cells

    • Galleria mellonella infection model as an intermediate host

    • Murine models of acute and chronic infection

  • Functional assessments:

    • Measurement of intracellular ATP levels as an indicator of energy metabolism

    • Membrane potential assays to assess proton-motive force generation

    • Oxygen consumption rate measurements

These approaches should consider that B. multivorans has been associated with poor clinical outcomes in CF patients, including "cepacia syndrome" , and that certain globally distributed strains may be better adapted to human infection than others . The study of nuoK in this context could reveal whether respiratory chain adaptations contribute to this enhanced virulence.

How can researchers effectively investigate the impact of nuoK mutations on antibiotic resistance in B. multivorans?

Based on recent studies showing potential parallel pathoadaptation involving antibiotic resistance genes in B. multivorans , investigating nuoK's role requires:

  • Minimum Inhibitory Concentration (MIC) determination:

    • Compare MICs of various antibiotics between wild-type and nuoK mutant strains

    • Assess the effect of sub-inhibitory antibiotic concentrations on nuoK expression

    • Evaluate synergistic effects of respiratory chain inhibitors with conventional antibiotics

  • Membrane permeability studies:

    • Fluorescent dye uptake assays to assess changes in membrane permeability

    • Lipidomic analysis to detect alterations in membrane composition

    • Electron microscopy to observe structural changes

  • Efflux pump activity:

    • Efflux pump inhibitor assays to determine if nuoK mutations affect drug efflux

    • Direct measurement of efflux activity using fluorescent substrates

    • Transcriptomic analysis to identify changes in efflux pump expression

Diaz Caballero et al. (2018) found that B. multivorans can develop resistance to multiple classes of antibiotics during chronic CF infection . Since respiratory chain components affect membrane potential, which drives some efflux pumps, nuoK mutations might contribute to this resistance phenotype through altered energetics or membrane properties.

What approaches can resolve contradictory data about nuoK function in B. multivorans energy metabolism?

When facing contradictory data regarding nuoK function, researchers should implement a systematic approach:

  • Standardization of experimental conditions:

    • Clearly define growth conditions (media, temperature, oxygen availability)

    • Ensure consistent genetic backgrounds across studies

    • Standardize protein expression and purification protocols

  • Multi-omics integration:

    • Combine transcriptomic, proteomic, and metabolomic data

    • Perform flux balance analysis to model energy metabolism

    • Use 13C-labeling experiments to track metabolic fluxes

  • Comparative analysis across strains:

    • Include reference strains like ATCC 17616 alongside clinical isolates

    • Consider strain-specific adaptations that might affect respiratory chain function

    • Analyze sequence types (STs) to understand genetic context, as B. multivorans has at least 64 different STs identified globally

The research on B. multivorans shows considerable strain diversity, with some strains better adapted to human infection than others . This genetic diversity likely extends to metabolic capabilities, potentially explaining contradictory findings about respiratory chain components like nuoK across different studies.

How can researchers distinguish between adaptive and neutral mutations in nuoK during evolution studies?

Distinguishing adaptive from neutral mutations in nuoK requires sophisticated evolutionary analysis:

  • Molecular evolution analyses:

    • Calculate dN/dS ratios to identify signatures of selection

    • Perform McDonald-Kreitman tests to compare polymorphism and divergence

    • Use ancestral sequence reconstruction to trace evolutionary trajectories

  • Experimental evolution approaches:

    • Conduct in vitro evolution experiments under conditions mimicking CF lungs

    • Perform competition assays between strains carrying different nuoK alleles

    • Use allelic replacement to test fitness effects of specific mutations

  • Clinical correlation studies:

    • Analyze nuoK sequences from longitudinal clinical isolates

    • Correlate specific mutations with clinical outcomes

    • Compare mutation patterns across patients to identify convergent evolution

Studies show that B. multivorans accumulates mutations at a rate of approximately 2.27 SNPs/year during chronic infection , with many mutations affecting genes related to oxidative stress response and metabolism. This evolutionary pattern suggests that adaptive mutations in respiratory chain components like nuoK might contribute to B. multivorans persistence in the CF lung environment.

What are the most promising future research directions for understanding nuoK's role in B. multivorans pathogenesis?

Based on current knowledge gaps and recent advances, the most promising research directions include:

  • Structural biology approaches:

    • Cryo-EM structure determination of the entire B. multivorans Complex I

    • X-ray crystallography of nuoK in complex with inhibitors

    • Molecular dynamics simulations to understand conformational changes

  • Host-pathogen interaction studies:

    • Investigation of nuoK regulation during different stages of infection

    • Examination of host immune responses to respiratory chain components

    • Assessment of nuoK adaptation in response to host environmental pressures

  • Therapeutic targeting strategies:

    • Screening for specific inhibitors of B. multivorans nuoK

    • Evaluation of respiratory chain inhibitors as antibiotic adjuvants

    • Development of attenuated strains with nuoK modifications as potential vaccine candidates

These approaches should consider that B. multivorans continues to emerge as a significant pathogen in CF infections despite infection control measures , suggesting that understanding its core metabolic processes like electron transport could reveal new therapeutic approaches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.