Recombinant Burkholderia multivorans Protease HtpX homolog (htpX)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request whenever possible.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage (up to one week), store working aliquots at 4°C.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is defined during the production process. If you have a specific tag type requirement, please inform us. We will prioritize developing the specified tag if possible.
Synonyms
htpX; Bmul_3121; BMULJ_00109; Protease HtpX homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-285
Protein Length
full length protein
Species
Burkholderia multivorans (strain ATCC 17616 / 249)
Target Names
htpX
Target Protein Sequence
MFNWVKTAMLMAAITALFIVIGGMIGGSRGMTIALLFALGMNFFSYWFSDKMVLRMYNAQ EVDENTAPQFYRMVRELATRANLPMPRVYLINEDAPNAFATGRNPEHAAVAATTGILRVL SEREMRGVMAHELAHVKHRDILISTITATMAGAISAIANFAMFFGGRDENGRPVNPIAGI AVALLAPIAGALIQMAISRAREFEADRGGAQISGDPQALASALDKIHRYAAGIPFQAAEA HPATAQMMIMNPLHGGGLQNLFSTHPATEERIARLMEMARTGRFD
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Burkholderia multivorans Protease HtpX homolog?

Burkholderia multivorans Protease HtpX homolog is an M48 family zinc metalloproteinase located in the cytoplasmic membrane. The protein consists of 285 amino acids and has a molecular function in proteolytic quality control of membrane proteins . Similar to its Escherichia coli counterpart, B. multivorans HtpX is thought to be involved in the elimination of misfolded or damaged membrane proteins, thus maintaining membrane integrity and function. The protein contains the characteristic HEXXH metalloprotease active site motif and requires zinc for its proteolytic activity .

What is the genetic organization of htpX in Burkholderia multivorans?

The htpX gene in Burkholderia multivorans (strain ATCC 17616 / 249) is designated as BmµL_3121 or BMµLJ_00109 in the genome annotations. The gene encodes a full-length protein of 285 amino acids with a predicted EC number of 3.4.24.- . The genetic context of htpX varies among different Burkholderia species, but the gene itself is highly conserved across the Burkholderia cepacia complex (Bcc), indicating its essential cellular function .

How does Burkholderia multivorans Protease HtpX differ from homologs in other bacterial species?

While the core functional domains of HtpX are conserved across bacterial species, B. multivorans HtpX shows specific sequence variations that may contribute to its specialized function. Sequence alignment reveals that B. multivorans HtpX shares significant homology with HtpX from other Burkholderia species, with 99% sequence identity to B. cepacia HtpX and approximately 82% identity to B. thailandensis HtpX . Compared to the E. coli homolog, which has been more extensively studied, the B. multivorans HtpX maintains the catalytic HEXXH motif but exhibits differences in transmembrane topology that may affect substrate specificity and regulation .

What are the recommended protocols for expression and purification of recombinant B. multivorans HtpX?

For successful expression and purification of functional recombinant B. multivorans HtpX, researchers should consider the following methodological approach:

  • Expression system selection: Due to HtpX being a membrane protein, expressing it in E. coli membrane-protein optimized strains such as C41(DE3) or C43(DE3) is recommended.

  • Vector design: Include a C-terminal affinity tag (His6 or His10) for purification while ensuring the tag doesn't interfere with the protease active site.

  • Purification procedure:

    • Isolate membranes via ultracentrifugation after cell lysis

    • Solubilize the membrane fraction using mild detergents (DDM or LDAO)

    • Perform metal affinity chromatography using Ni-NTA or TALON resin

    • Apply size-exclusion chromatography for final purification

  • Storage conditions: Store in Tris-based buffer with 50% glycerol at -20°C for regular use or -80°C for extended storage. Avoid repeated freeze-thaw cycles and maintain working aliquots at 4°C for up to one week .

The protein should be handled carefully with proper consideration of its hydrophobic nature as a membrane protein, which may affect solubility and stability during purification.

How can researchers effectively assess the protease activity of B. multivorans HtpX?

To assess the protease activity of B. multivorans HtpX, researchers can adapt the in vivo protease activity assay systems developed for E. coli HtpX. The methodology involves:

  • Construction of model substrates:

    • Design fusion proteins containing domains that would be recognized by HtpX

    • Include detection tags such as GFP or epitope tags for monitoring cleavage

  • Expression system setup:

    • Co-express the model substrate with wild-type or mutant HtpX

    • Include appropriate controls (inactive HtpX mutants, no HtpX expression)

  • Detection methods:

    • Western blotting to detect substrate cleavage products

    • Fluorescence-based assays if using fluorescent protein fusions

    • Mass spectrometry to identify precise cleavage sites

  • Quantification approach:

    • Measure the ratio of cleaved to uncleaved substrate

    • Compare activity rates between wild-type and mutant forms

    • Assess effects of inhibitors (metal chelators like EDTA or 1,10-phenanthroline)

This system enables semi-quantitative assessment of HtpX activity and can be utilized to study the effects of mutations in conserved regions of the protease.

How does HtpX contribute to antimicrobial resistance in Burkholderia multivorans?

HtpX's contribution to antimicrobial resistance in B. multivorans appears to involve several mechanisms:

  • Membrane integrity maintenance: By eliminating misfolded membrane proteins, HtpX helps maintain membrane barrier function, which is critical for intrinsic resistance to many antibiotics.

  • Stress response mechanism: HtpX functions as part of the cellular stress response, helping B. multivorans adapt to antibiotic and other environmental stresses. During antibiotic exposure, HtpX may play a role in remodeling the membrane proteome to enhance survival.

  • Complementary proteolytic pathways: Similar to findings in other bacterial systems, HtpX likely works in concert with other proteases like FtsH to maintain membrane protein homeostasis under stress conditions.

  • Potential role in virulence factor processing: While not directly demonstrated for B. multivorans HtpX, protease homologs in other bacteria have been implicated in processing virulence factors that contribute to pathogenesis and antimicrobial evasion .

Research with B. thailandensis demonstrates that deletion of hpnN (a gene involved in hopanoid transport) resulted in increased sensitivity to multiple antibiotics including chloramphenicol, novobiocin, and polymyxin B. Similar membrane remodeling mechanisms involving proteases like HtpX may contribute to B. multivorans multidrug resistance .

What is known about the regulation of htpX expression in Burkholderia multivorans?

The regulation of htpX expression in B. multivorans remains incompletely characterized, but insights can be drawn from studies of related bacteria:

  • Stress-responsive regulation: In E. coli and potentially in Burkholderia species, htpX expression is induced under conditions that generate misfolded membrane proteins, including:

    • Heat stress

    • Exposure to membrane-disrupting compounds

    • Growth in biofilms

    • Oxygen limitation

  • Transcriptional control: While specific transcription factors controlling B. multivorans htpX have not been fully characterized, genomic analyses suggest the involvement of:

    • Sigma factors responsive to membrane stress

    • Two-component regulatory systems that sense environmental stresses

  • Genomic context factors: Analysis of genomic sequences reveals that B. multivorans isolates show conservation of htpX across strains, but regulatory elements may differ between environmental and clinical isolates, potentially reflecting adaptation to different niches .

During chronic infections in cystic fibrosis patients, B. multivorans undergoes adaptive evolution, accumulating mutations at a rate of approximately 2.27 SNPs/year. The htpX gene could be subject to selection pressures during this adaptation process, potentially affecting its expression and function .

How can CRISPR/Cas9 genome editing be applied to study HtpX function in Burkholderia multivorans?

CRISPR/Cas9 genome editing offers powerful approaches for investigating HtpX function in B. multivorans, with recent methodological advances making this more accessible:

  • CRISPR system selection and optimization:

    • Utilize plasmid pCasPA containing cas9 and λ-Red system genes with tetracycline resistance

    • Consider alternative resistance markers (chloramphenicol, kanamycin, or trimethoprim) for selection in B. multivorans strains with different antibiotic resistance profiles

    • Achieve mobilization through triparental conjugation from E. coli to B. multivorans

  • Experimental design strategies:

    • Gene knockout: Complete deletion of htpX to assess loss-of-function phenotypes

    • Point mutations: Introduction of specific mutations in the catalytic site (e.g., in the HEXXH motif) to generate catalytically inactive variants

    • Domain swapping: Replace domains with those from other bacterial species to assess specificity

    • Tagging: Add reporter tags for localization and interaction studies

  • Analytical approaches for phenotypic assessment:

    • Antibiotic susceptibility testing of htpX mutants

    • Membrane proteome analysis by mass spectrometry

    • Stress response induction under various conditions

    • Virulence assessment in infection models

The successful implementation of this methodology requires optimization for the specific B. multivorans strain being studied, as conjugation frequencies have been shown to vary between environmental and clinical isolates.

What methods are available for identifying physiological substrates of HtpX in Burkholderia multivorans?

Identifying physiological substrates of HtpX in B. multivorans requires multi-faceted approaches:

  • Proteomics-based substrate identification:

    • Comparative proteomics: Compare membrane proteomes of wild-type vs. ΔhtpX strains

    • SILAC or TMT labeling for quantitative assessment

    • Enrichment strategies for membrane proteins

    • N-terminomics to identify specific cleavage sites

  • Interaction-based approaches:

    • Substrate-trapping mutants: Engineer catalytically inactive HtpX variants that bind but don't cleave substrates

    • Cross-linking coupled with mass spectrometry (XL-MS)

    • Co-immunoprecipitation with epitope-tagged HtpX

    • Bacterial two-hybrid or split-protein complementation assays

  • Bioinformatic prediction of substrates:

    • Sequence-based prediction of cleavage sites

    • Structural modeling of substrate recognition

    • Comparative genomics across Burkholderia species

  • Validation methods:

    • In vitro cleavage assays with purified components

    • Mutational analysis of predicted cleavage sites

    • Stability assays of candidate substrates in vivo

This combined approach has successfully identified substrates for proteases in other bacterial systems and should be adaptable to B. multivorans HtpX research.

How can structural biology approaches enhance our understanding of B. multivorans HtpX?

Structural biology approaches provide crucial insights into HtpX function through:

  • Structural determination methodologies:

    • X-ray crystallography: Challenges include HtpX being a membrane protein, requiring detergent screening or lipidic cubic phase crystallization

    • Cryo-electron microscopy: Particularly suitable for membrane proteins like HtpX

    • NMR spectroscopy: For dynamic studies of specific domains

    • Computational structure prediction: Using AlphaFold2 or similar tools as a starting point

  • Functional insights from structural studies:

    • Active site architecture: Precise positioning of the HEXXH motif and zinc coordination

    • Substrate binding pocket analysis: Identification of specificity-determining residues

    • Transmembrane topology mapping: Understanding how HtpX integrates into the membrane

    • Conformational changes: Assessing structural rearrangements during catalysis

  • Structure-guided experimental design:

    • Rational mutagenesis of key residues identified in the structure

    • Design of specific inhibitors or activity-based probes

    • Structure-based engineering of substrate specificity

For membrane proteins like HtpX, structural studies can be particularly challenging but informative. The crystal structures of related transporters like HpnN from B. multivorans provide methodological precedents for approaching membrane protein structural biology in this organism .

How has HtpX evolved within the Burkholderia cepacia complex?

The evolutionary trajectory of HtpX within the Burkholderia cepacia complex reveals important patterns:

  • Sequence conservation patterns:

    • The core catalytic domain containing the HEXXH motif shows high conservation across all Bcc species

    • Transmembrane domains exhibit higher variability, possibly reflecting adaptation to different membrane compositions

    • Comparing sequences from B. multivorans (A9AC67), B. cepacia (Q39BU7), and other Bcc species reveals:

    Bcc SpeciesSequence Identity to B. multivorans HtpXNotable Differences
    B. cepacia~99%Few variations in transmembrane regions
    B. cenocepacia~95%Variations in substrate-binding regions
    B. vietnamiensis~92%C-terminal domain variations
    B. dolosa~90%N-terminal signal sequence differences
  • Evolutionary pressure analysis:

    • Genomic studies of B. multivorans and B. cenocepacia co-infections show that while some genes accumulate mutations at rates of 2.08-2.27 SNPs/year, the htpX locus appears relatively stable

    • This suggests evolutionary conservation due to essential function

    • Unlike genes involved in lipopolysaccharide synthesis or regulatory functions that show signs of positive selection, htpX exhibits predominantly purifying selection

  • Horizontal gene transfer considerations:

    • Genomic context analysis suggests htpX is part of the core genome rather than mobile genetic elements

    • No evidence of recent horizontal acquisition between Burkholderia species

This evolutionary conservation suggests that HtpX serves a fundamental role in Burkholderia membrane protein quality control that has been maintained throughout the diversification of the Bcc.

What can comparative genomics tell us about HtpX variants in clinical versus environmental B. multivorans isolates?

Comparative genomics analyses reveal important distinctions between HtpX in clinical and environmental isolates:

The data from ST-742 isolates studied in Belgium provide a particularly valuable model, showing that even when starting from the same sequence type, B. multivorans undergoes patient-specific genomic evolution while maintaining core functions like those mediated by HtpX .

How might targeting HtpX affect Burkholderia multivorans virulence and antimicrobial resistance?

Targeting HtpX as a therapeutic strategy presents several considerations:

  • Potential impact on virulence:

    • Disruption of membrane protein quality control could attenuate bacterial fitness during infection

    • HtpX inhibition might disrupt stress response mechanisms required for adaptation to the host environment

    • The immunoproteome analysis of B. multivorans indicates that several membrane-associated proteins are immunogenic during human infection; HtpX-mediated processing may affect presentation of these antigens

  • Antimicrobial resistance implications:

    • Studies with other membrane proteases suggest that inhibition could sensitize bacteria to membrane-targeting antibiotics

    • HtpX inhibition might be particularly effective in combination therapy approaches

    • Analogous to findings with the HpnN transporter in B. thailandensis, where disruption increased susceptibility to polymyxin B, chloramphenicol, and novobiocin

  • Experimental considerations for validation:

    • Generate conditional htpX mutants to assess viability effects

    • Evaluate changes in minimum inhibitory concentrations (MICs) for various antibiotic classes

    • Assess virulence in appropriate infection models

    • Screen for small molecule inhibitors of HtpX protease activity

While direct evidence specifically for B. multivorans HtpX remains limited, the conserved role of this protease family in membrane homeostasis suggests that targeting it could disrupt mechanisms important for both virulence and antimicrobial resistance.

What challenges exist in developing assays for high-throughput screening of HtpX inhibitors?

Developing high-throughput screening assays for HtpX inhibitors faces several methodological challenges:

  • Membrane protein assay limitations:

    • HtpX's membrane localization complicates traditional enzyme assays

    • Detergent requirements may interfere with compound screening

    • Maintaining native conformation and activity during purification and assay development

  • Substrate selection considerations:

    • Lack of well-defined physiological substrates necessitates development of model substrates

    • Fluorogenic or chromogenic peptide substrates must be designed based on predicted cleavage preferences

    • Assay specificity must be validated to ensure hits truly target HtpX rather than related proteases

  • Technical assay development strategies:

    • Cell-based reporter systems: Fusion proteins that release detectable signals upon cleavage

    • In vitro reconstituted systems: Purified HtpX in membrane mimetics (nanodiscs, liposomes)

    • Activity-based protein profiling: Using chemical probes that report on active site accessibility

  • Validation workflow requirements:

    • Orthogonal assays to confirm hits from primary screens

    • Selectivity panels against related metalloproteases

    • Mechanism of action studies to confirm on-target activity

The adaptation of the in vivo protease activity assay developed for E. coli HtpX provides a promising starting point, but substantial optimization would be needed to transform this into a format suitable for high-throughput screening .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.