Recombinant Burkholderia phymatum 4-hydroxybenzoate octaprenyltransferase (ubiA)

Shipped with Ice Packs
In Stock

Description

Protein Structure

The enzyme belongs to the UbiA family of prenyltransferases, characterized by:

  • Eight/nine transmembrane helices arranged in two pseudosymmetric bundles .

  • Conserved motifs:

    • First aspartate-rich motif: NDXXDXXXD (coordinates Mg²⁺ and substrate).

    • Second aspartate-rich motif: DXXXD (binds Mg²⁺ and stabilizes diphosphate groups) .

  • Active site: Residues N68, D72, D198, D202, and Y139 form a catalytic cluster, critical for Mg²⁺ binding and substrate cleavage .

Enzymatic Activity

  • Reaction:
    4-HB+octaprenyl diphosphateMg2+4-hydroxy-3-octaprenylbenzoate+PPi4\text{-HB} + \text{octaprenyl diphosphate} \xrightarrow{\text{Mg}^{2+}} 4\text{-hydroxy-3-octaprenylbenzoate} + \text{PP}_i

  • Mechanism: Cleavage of the C–O bond in octaprenyl diphosphate, transferring the prenyl chain to the ortho position of 4-HB .

Ubiquinone Biosynthesis

UbiA is pivotal in CoQ synthesis, a lipid-soluble electron carrier in bacterial respiratory chains. Defects in UbiA homologs (e.g., human UBIAD1) are linked to diseases like Schnyder corneal dystrophy .

Bacterial Metabolism

In Burkholderia spp., ubiA contributes to metabolic versatility, including polyhydroxyalkanoate (PHA) production and biofilm formation via exopolysaccharides like cepacian .

Mechanistic Studies

  • Structural Insights: Crystallographic studies of AfUbiA (archaeal homolog) revealed Mg²⁺ coordination and substrate binding sites .

  • Mutagenesis: Residues D72, D202, and Y139 are essential for activity; mutations abolish function in E. coli MenA .

Inhibitor Development

  • Dihydroxyacetone (DHB): A substrate mimic that binds UbiA, preventing prenyl transfer and inhibiting CoQ synthesis .

Biotechnological Use

  • Recombinant Production: Used in assays to study prenylation kinetics and enzyme-substrate interactions .

  • Phylogenetic Analysis: UbiA homologs in plants (e.g., Citrus spp.) catalyze O-prenylation of coumarins, highlighting evolutionary divergence .

Comparison of Key Biochemical Features

FeatureUbiA (Burkholderia phymatum)UbiA Homologs (General)
Substrate4-Hydroxybenzoate + octaprenyl diphosphateDiverse aromatic acceptors
Catalytic MechanismMg²⁺-dependent C–O bond cleavageConserved across UbiA family
InhibitorsDihydroxyacetone (DHB) Species-specific analogs
Structural MotifsTwo aspartate-rich motifs Eight/nine transmembrane helices

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipment is required, please communicate with us beforehand, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
ubiA; Bphy_2519; 4-hydroxybenzoate octaprenyltransferase; 4-HB polyprenyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-287
Protein Length
full length protein
Species
Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815) (Burkholderia phymatum)
Target Names
ubiA
Target Protein Sequence
MFARLPLYLRLVRMDKPIGSLLLLWPTLNALWIASDGHPSVSLLVIFALGTILMRSAGCA INDYADRDFDRYVKRTENRPITSGKIKAWEAVALAAGLSLVAFLLILPLNALTKELSVAA LFVAGTYPFTKRFFAIPQAYLGIAFGFGIPMAFAAVQNQVPLLAWVMLIANVFWSVAYDT EYAMVDRDDDIKIGIRTSALTFGRFDVLAIMLCYAVTLGIYVGIGFTLGFGVLYWIGLAA AAGCAVYHYTLIKGRERMPCFAAFRHNNWLGGALFAGIAAHYAAQAF
Uniprot No.

Target Background

Function
This enzyme catalyzes the prenylation of para-hydroxybenzoate (PHB) with an all-trans polyprenyl group. It mediates the second step in the final reaction sequence of ubiquinone-8 (UQ-8) biosynthesis. This step involves the condensation of the polyisoprenoid side chain with PHB, resulting in the formation of the first membrane-bound Q intermediate, 3-octaprenyl-4-hydroxybenzoate.
Database Links
Protein Families
UbiA prenyltransferase family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of 4-hydroxybenzoate octaprenyltransferase (ubiA) in Burkholderia phymatum metabolism?

4-hydroxybenzoate octaprenyltransferase (ubiA) in Burkholderia phymatum plays a crucial role in the ubiquinone biosynthesis pathway. This membrane-bound enzyme catalyzes the attachment of 4-hydroxybenzoate to membrane-bound octaprenyl diphosphate, forming 3-octaprenyl-4-hydroxybenzoate . This reaction represents one of the initial committed steps in ubiquinone (coenzyme Q) biosynthesis.

Ubiquinone functions as an essential electron carrier in the respiratory chain and contributes to the organism's energy metabolism. In B. phymatum specifically, functional ubiquinone biosynthesis may support the high-energy requirements associated with nitrogen fixation processes that make this bacterium an effective symbiont with leguminous plants, particularly Mimosa species .

The ubiA gene exists within a conserved operon structure in many bacterial species, and its expression is often regulated in response to oxygen availability and metabolic demands.

How does Burkholderia phymatum ubiA differ from homologous enzymes in other bacterial species?

Burkholderia phymatum ubiA belongs to the UbiA superfamily of prenyltransferases found across bacterial species. While the core catalytic domain remains conserved, several notable differences exist in B. phymatum ubiA compared to homologs in other species:

  • Substrate specificity: While the primary function involves 4-hydroxybenzoate prenylation, B. phymatum ubiA may exhibit slightly different substrate preferences regarding the length and configuration of the prenyl donor.

  • Membrane topology: As a membrane-bound enzyme, B. phymatum ubiA contains multiple transmembrane domains. The number and arrangement of these domains may differ from homologs in other species, affecting membrane integration and activity.

  • Catalytic efficiency: Preliminary enzyme kinetic analyses suggest that B. phymatum ubiA may have evolved specialized catalytic properties that optimize function within the unique metabolic background of this nitrogen-fixing bacterium.

  • Regulatory elements: The expression regulation of ubiA in B. phymatum likely reflects adaptation to its symbiotic lifestyle, showing distinct patterns compared to free-living bacteria.

The symbiotic capabilities of B. phymatum, particularly its effectiveness in nodulating Mimosa species and fixing nitrogen both in nodules and in free-living conditions , suggest that its metabolic enzymes, including ubiA, may have evolved specific adaptations supporting these specialized functions.

What expression systems are recommended for producing recombinant Burkholderia phymatum ubiA?

Successful expression of recombinant B. phymatum ubiA requires careful consideration of expression systems due to its membrane-bound nature. Based on research with similar prenyl transferases, the following expression systems have demonstrated efficacy:

Table 1: Comparison of Expression Systems for Recombinant B. phymatum ubiA

Expression SystemAdvantagesChallengesYieldRecommended Conditions
E. coli BL21(DE3)Well-established protocols; cost-effectivePotential membrane integration issues; inclusion body formationModerateInduction: 0.1-0.5 mM IPTG at 18°C for 16-20 hours
E. coli C41/C43Specialized for membrane proteins; reduced toxicityLonger expression times; lower growth ratesGoodInduction: 0.1 mM IPTG at 20°C for 20-24 hours
Pichia pastorisPost-translational modifications; natural membrane integrationComplex protocols; longer development timeHighMethanol induction; maintain pH 6.0-7.0 during expression
Cell-free systemsEliminates toxicity issues; direct membrane incorporationExpensive; technically challengingVariableSupplementation with lipid nanodiscs or liposomes

For enhanced expression, fusion partners such as His-tags (as used with UbiB protein ) can facilitate purification while thioredoxin or MBP fusions may improve solubility. When expressing in E. coli, codon optimization is recommended to address potential codon bias issues between Burkholderia and the expression host.

What purification strategies yield the highest purity of recombinant ubiA?

Purifying recombinant B. phymatum ubiA presents significant challenges due to its hydrophobicity and membrane integration. A multi-step purification strategy is typically required to achieve high purity while maintaining enzyme activity.

Recommended Purification Workflow:

  • Membrane Isolation:

    • Cell disruption via sonication or French press in buffer containing protease inhibitors

    • Differential centrifugation to isolate membrane fractions (typically 100,000 × g for 1 hour)

    • Membrane solubilization using detergents (DDM, LDAO, or Triton X-100 at 0.5-2%)

  • Affinity Chromatography:

    • Immobilized metal affinity chromatography (IMAC) for His-tagged constructs

    • Buffer composition: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 0.05% detergent

    • Gradual imidazole elution (20-500 mM) to separate non-specific binding proteins

  • Secondary Purification:

    • Ion exchange chromatography (typically DEAE or Q-Sepharose)

    • Size exclusion chromatography to remove aggregates and obtain monodisperse protein

Table 2: Troubleshooting Common Purification Issues

IssuePossible CauseSolution
Low yield from IMACPoor tag accessibilityModify tag position or add linker sequence
Protein aggregationDetergent concentration too lowIncrease detergent concentration or try alternative detergents
Loss of activityDetergent-induced conformational changesScreen detergents; use milder options like DDM or nanodisc reconstitution
Co-purifying contaminantsNon-specific binding to resinInclude low imidazole (10-20 mM) in binding buffer; add secondary purification step
Proteolytic degradationEndogenous proteasesAdd protease inhibitors; reduce purification time; maintain cold temperatures

For successful purification, detergent selection is critical. Similar protocols used for the purification of UbiB protein from B. phymatum have demonstrated that maintaining protein in a Tris/PBS-based buffer with appropriate additives can preserve stability .

How can researchers ensure proper folding and membrane integration of recombinant ubiA?

Ensuring proper folding and membrane integration of recombinant B. phymatum ubiA is essential for obtaining functionally active enzyme. Several strategies can address this challenge:

  • Co-expression with Chaperones:

    • GroEL/GroES system helps prevent aggregation during translation

    • DnaK/DnaJ/GrpE system assists in proper folding of nascent polypeptides

    • Specialized membrane protein chaperones like YidC can aid membrane insertion

  • Membrane Mimetic Systems:

    • Detergent micelles: DDM, LDAO, or FC-12

    • Lipid nanodiscs: MSP1D1 scaffold with E. coli lipids

    • Liposomes: POPC/POPE mixtures for reconstitution

    • Amphipols: A8-35 or PMAL-C8 as detergent alternatives

  • Expression Conditions Optimization:

    • Lower temperatures (16-25°C) to slow translation and folding

    • Reduced inducer concentrations to prevent overwhelming cellular machinery

    • Extended induction periods (16-24 hours) to allow proper folding

  • Validation Techniques:

    • Circular dichroism spectroscopy to assess secondary structure

    • Limited proteolysis to evaluate folding compactness

    • Fluorescence-detection size exclusion chromatography (FSEC) to assess monodispersity

    • Functional assays to confirm activity as the ultimate validation

When working with membrane proteins like ubiA, it's crucial to maintain the cold chain during purification and avoid freeze-thaw cycles that can disrupt protein-detergent complexes. Storage recommendations similar to those used for other B. phymatum proteins (as seen with UbiB) include maintaining aliquots at -20°C/-80°C with the addition of glycerol (typically 5-50%) as a cryoprotectant .

What approaches can be used when experimental data contradicts hypotheses about ubiA function?

When experimental data contradicts hypotheses about B. phymatum ubiA function, researchers should follow a systematic troubleshooting and re-evaluation process:

  • Validate the Experimental System:

    • Confirm enzyme activity with positive controls using homologous enzymes

    • Verify assay components are functioning properly

    • Check for interfering compounds or conditions

  • Revisit Experimental Design:

    • Evaluate if membrane environment adequately mimics native conditions

    • Assess whether purification methods maintain protein integrity

    • Consider tag position effects on enzyme activity

  • Expand Hypothesis Framework:

    • Consider alternative substrates or substrate preferences

    • Evaluate potential regulatory mechanisms affecting activity

    • Assess potential for enzyme bifunctionality or moonlighting functions

  • Apply Advanced Analytical Techniques:

    • Use site-directed mutagenesis to probe specific amino acids

    • Perform structural studies (if possible) to gain insights into unexpected results

    • Consider computational modeling to generate new hypotheses

  • Contextual Interpretation:

    • Frame results within the biological context of B. phymatum

    • Consider evolutionary adaptations related to symbiotic lifestyle

    • Evaluate how nitrogen fixation metabolism might influence enzyme function

When facing unexpected data, researchers should view contradictions as opportunities for discovery rather than experimental failures . The unique ecological niche of B. phymatum as both a free-living nitrogen-fixing bacterium and a symbiont might have driven evolutionary adaptations in its metabolic enzymes that deviate from canonical functions observed in model organisms.

How can researchers distinguish between substrate specificity variations and experimental artifacts?

Distinguishing genuine substrate specificity variations of B. phymatum ubiA from experimental artifacts requires rigorous experimental controls and analytical approaches:

Methodological Controls to Implement:

  • Substrate Quality Control:

    • Analytical verification of substrate purity (HPLC, NMR)

    • Fresh preparation of unstable substrates

    • Multiple independent substrate preparations

  • Enzyme Quality Assessment:

    • Multiple independent enzyme preparations

    • Activity validation with established substrates

    • Time-course experiments to ensure linearity

  • Assay Robustness Testing:

    • pH and buffer composition variations

    • Detergent type and concentration screening

    • Temperature dependence studies

Analytical Framework for Distinguishing Real Effects:

Table 3: Decision Matrix for Interpreting Unexpected Results

ObservationIf Consistent Across ConditionsIf Variable Across ConditionsLikely Interpretation
Altered substrate preferenceObserved with multiple enzyme preps and assay methodsVaries with detergent or bufferTrue specificity difference if consistent
Unexpected kinetic parametersReproducible and fit theoretical modelsChanges with protein concentration or detergentTrue kinetic property if consistent
Novel product formationConfirmed by multiple analytical methodsAppears only under certain extraction conditionsTrue novel activity if consistently detected
Inhibition patternsReproducible dose-response relationshipsVaries with order of addition or preincubationTrue inhibition if consistent dose-response

When evaluating potential substrate specificity variations, researchers should draw parallels with related enzymes. For instance, the acetylene reduction assay (ARA) methodology used to study B. phymatum nitrogen fixation capabilities demonstrates how specific activity assays can reveal genuine biological differences between similar bacterial species.

How does ubiA activity relate to the nitrogen-fixing capabilities of Burkholderia phymatum?

The relationship between ubiA activity and the nitrogen-fixing capabilities of B. phymatum represents an intriguing intersection of primary metabolism and symbiotic function:

  • Energetic Requirements:

    • Nitrogen fixation is highly energy-intensive, requiring significant ATP

    • Ubiquinone, produced through the ubiA pathway, is essential for efficient respiratory electron transport

    • Efficient ubiquinone biosynthesis may support the high energetic demands of nitrogen fixation

  • Microaerobic Adaptation:

    • Nitrogenase is oxygen-sensitive, requiring microaerobic conditions

    • Ubiquinone plays critical roles in both aerobic and microaerobic respiration

    • ubiA regulation may be integrated with oxygen-sensing systems

  • Experimental Approaches to Investigate This Relationship:

    • Generate controlled ubiA expression mutants and assess nitrogen fixation capabilities

    • Compare ubiquinone content in free-living versus symbiotic states

    • Evaluate ubiA expression patterns during nodule formation and nitrogen fixation

B. phymatum has been demonstrated to be highly effective at nitrogen fixation both in symbiosis with Mimosa plants and in free-living conditions. In comparative studies, B. phymatum STM815 showed greater nitrogenase activity in nodules than other bacteria like Cupriavidus taiwanensis LMG19424. Additionally, B. phymatum demonstrated significant acetylene reduction assay activity in ex planta conditions, indicating robust nitrogen fixation capabilities .

This unique metabolic versatility suggests that B. phymatum may have evolved specialized regulatory mechanisms coordinating primary metabolism (including ubiquinone biosynthesis) with nitrogen fixation, potentially including adaptations in ubiA function or regulation.

How can structural biology approaches advance our understanding of Burkholderia phymatum ubiA?

Structural biology approaches can significantly advance our understanding of B. phymatum ubiA by revealing molecular details of substrate binding, catalytic mechanism, and membrane integration:

Implementation Strategy:

The structural characterization of membrane proteins often requires specialized approaches. For example, structural studies of MenB in the menaquinone biosynthesis pathway revealed a deep active site pocket lined with conserved residues (Asp-192, Tyr-287) essential for catalysis . Similar methodologies could be applied to ubiA, though with adaptations for its membrane-bound nature.

When planning structural biology experiments with ubiA, researchers should consider the successful approaches used for other prenyl transferases, including the use of detergent screening, stability assays, and construct optimization to identify protein variants most amenable to structural studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.