Recombinant Burkholderia phymatum Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months under the same conditions.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. Please specify your desired tag type for preferential development.
Synonyms
mscL; Bphy_0993; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-149
Protein Length
full length protein
Species
Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815) (Burkholderia phymatum)
Target Names
mscL
Target Protein Sequence
MSLVTEFKEFALKGNVMDLAVGVIIGGAFSTIVNSVVKDLIMPVVGVATGGLDFSNKFIL LGHIPPNFKGNPDSYKDLQTAGVAAFGYGSFITVAINFVILALIIFMMVKFINKLRAPAP AEAAAPPPTPEDVLLLREIRDSLKNSPRV
Uniprot No.

Target Background

Function

Mechanosensitive channel of large conductance (MscL) from Burkholderia phymatum is a membrane protein that opens in response to membrane tension. It plays a potential role in regulating cellular osmotic pressure.

Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Large-conductance Mechanosensitive Channel (MscL) and what is its function in bacteria?

The Large Conductance Mechanosensitive Channel (MscL) is a membrane protein that opens in response to stretch forces in the lipid bilayer. Microbial cells constitutively express MscL as a protective mechanism against osmotic shock. During the stationary phase and during osmotic shock events, the channel protein is up-regulated to prevent cell lysis by allowing rapid efflux of solutes when the cell experiences hypoosmotic stress . The channel gates via the bilayer mechanism, which is evoked by hydrophobic mismatch and changes in the membrane curvature and/or transbilayer pressure profile .

What is Burkholderia phymatum and why is it of scientific interest?

Burkholderia phymatum is a soil bacterium that belongs to the β-proteobacteria class. It has garnered significant scientific interest due to its ability to develop nitrogen-fixing symbiotic relationships with legumes, particularly species of the Mimosa genus . B. phymatum STM815T, the type strain, was isolated from a root nodule in French Guiana in 2000 and is characterized as an aerobic, motile, non-spore forming, Gram-negative rod . This bacterium is highly competitive for nodulation compared to other Mimosa symbionts and demonstrates a broader host range, effectively nodulating 30 out of 31 Mimosa species tested in research studies . B. phymatum is also notable for being the first reported β-rhizobial strain capable of fixing nitrogen in free-living culture, making it an important model organism for studying alternative nitrogen fixation pathways .

What is the molecular structure of MscL proteins and how does it relate to function?

MscL forms a homopentamer with each subunit containing two transmembrane regions . This pentameric structure is critical for its function as a mechanosensitive channel. When reconstituted into artificial liposomes, the purified MscL protein forms ion channels that exhibit characteristic conductance and pressure sensitivity . The channel's ability to sense mechanical force is directly related to its structural interaction with the lipid bilayer. When sufficient membrane tension is applied, the channel undergoes a conformational change from a closed to an open state, creating a large pore through which ions and small solutes can pass. This structural transition is essential for its role in osmoregulation during hypoosmotic shock .

What are the established methods for expressing and purifying recombinant MscL?

Based on techniques used for other bacterial MscL proteins, recombinant MscL can be expressed as a fusion protein with glutathione S-transferase (GST). The experimental approach includes:

  • Cloning the MscL gene into an expression vector that encodes MscL as a fusion protein with GST

  • Transforming the construct into an E. coli expression strain, preferably one with a disruption in the chromosomal mscL gene to prevent interference

  • Purifying the fusion protein using glutathione-coated beads in an affinity chromatography setup

  • Performing thrombin cleavage to separate the MscL protein from the GST tag

  • Recovering the purified MscL protein for functional reconstitution

This approach has been successfully used for E. coli MscL and could be adapted for B. phymatum MscL with appropriate modifications to account for potential differences in protein properties.

How can recombinant MscL be functionally reconstituted for experimental studies?

Functional reconstitution of recombinant MscL can be achieved by incorporating the purified protein into artificial liposomes. The reconstituted channels can then be examined using the patch-clamp technique to assess their functionality. Successfully reconstituted MscL proteins should exhibit several characteristic properties:

  • Formation of ion channels with conductance values typical for MscL

  • Pressure sensitivity appropriate for mechanosensitive channels

  • Susceptibility to known MscL inhibitors such as gadolinium

  • Ability to generate specific antibodies that can modulate channel activity

This reconstitution approach allows researchers to study the biophysical properties of MscL proteins in a controlled membrane environment, facilitating detailed electrophysiological characterization.

What genetic tools are available for manipulating Burkholderia species to study MscL?

Several genetic tools have been developed for Burkholderia species that could be applied to study MscL:

  • CRISPR/Cas9-based genome editing systems: A modified two-plasmid system (pCasPA and pACRISPR) has been successfully implemented for genome editing in Burkholderia multivorans and could potentially be adapted for B. phymatum .

  • Tri-parental mating: This technique has been used for genetic manipulation of Paraburkholderia strains and involves:

    • Using E. coli DH5α containing pRK2013 as a helper strain

    • Using E. coli with appropriate plasmids as donors

    • Transferring genetic material to the recipient Burkholderia strain

  • Transposon mutagenesis: This approach has been used to identify genes important for symbiosis in P. phymatum MP20 and could be employed to study MscL function .

  • Allelic exchange methods: These techniques allow for unmarked gene deletions, although they are more time-consuming than CRISPR/Cas9-based approaches .

How can CRISPR/Cas9 systems be specifically applied to study MscL in Burkholderia phymatum?

The CRISPR/Cas9 system can be applied to study MscL in B. phymatum through the following steps:

  • Design and construction of a two-plasmid system:

    • One plasmid carrying the cas9 gene and the λ-Red system genes

    • A second plasmid containing:

      • The appropriate guide RNA targeting the mscL gene

      • Homology repair arms for precise gene editing

      • A selection marker (e.g., resistance to kanamycin, chloramphenicol, or trimethoprim)

  • Mobilization of the plasmids to B. phymatum through triparental conjugation .

  • Selection of transformants using appropriate antibiotics.

  • Confirmation of successful genome editing through PCR amplification and sequencing.

  • Curing of plasmids by growing cells at lower temperatures (18–20°C) with passages to new liquid medium every 24 hours and screening for antibiotic sensitivity .

This approach allows for precise genetic manipulation of the mscL gene, facilitating studies of gene knockout, site-directed mutagenesis, or gene replacement to investigate MscL function in B. phymatum.

How might MscL function in Burkholderia phymatum relate to its symbiotic lifestyle with legumes?

While direct evidence linking MscL function to symbiotic relationships is not provided in the search results, we can hypothesize several potential connections:

  • Osmotic adaptation during host colonization: During the colonization of legume roots, B. phymatum likely encounters changing osmotic environments. MscL could play a crucial role in adapting to these osmotic shifts, particularly during the transition from soil to plant tissues .

  • Stress response during infection: The infection process might trigger stress responses in both the plant and the bacterium. MscL could contribute to bacterial survival under these stress conditions .

  • Biofilm formation: Some mechanosensitive channels have been implicated in biofilm formation in other bacteria. If MscL plays a similar role in B. phymatum, it might influence the establishment of symbiotic structures .

  • Coordination with other cellular systems: MscL might functionally interact with other systems important for symbiosis, such as Type VI Secretion Systems (T6SS) which have been shown to affect the competitive ability of P. phymatum in plant infection .

What experimental approaches can be used to investigate the role of MscL in osmotic adaptation during plant-microbe interactions?

To investigate the role of MscL in plant-microbe interactions, researchers could employ these experimental approaches:

  • Generation of mscL mutants using CRISPR/Cas9 or other genetic tools .

  • Comparative assessment of wild-type and mscL mutant strains for:

    • Root colonization efficiency on legume hosts such as Mimosa pudica

    • Competitive ability against other Paraburkholderia species in plant infection assays

    • Nodulation kinetics and effectiveness

    • Nitrogen fixation capacity measured by acetylene reduction assay (ARA)

  • Microscopic analysis of plant infection:

    • Using fluorescently tagged bacteria to visualize infection processes

    • Comparing wild-type and mscL mutant strains for differences in tissue colonization patterns

    • Examining potential alterations in nodule development and structure

  • Transcriptomic profiling:

    • Analyzing gene expression changes in wild-type and mscL mutant strains during plant infection

    • Identifying potential regulatory networks involving MscL

    • Comparing expression patterns across different stages of symbiosis

What are the key considerations for designing experiments to study recombinant B. phymatum MscL?

When designing experiments to study recombinant B. phymatum MscL, researchers should consider:

  • Genetic background: Use strains with disrupted native mscL genes to prevent interference with the recombinant protein's function .

  • Expression system optimization:

    • Codon optimization for expression in E. coli or other host systems

    • Selection of appropriate promoters for controlled expression

    • Fusion tag selection (e.g., GST) to facilitate purification while minimizing functional impact

  • Protein purification conditions:

    • Optimization of detergent type and concentration for membrane protein extraction

    • Buffer composition to maintain protein stability

    • Appropriate methods for tag removal that preserve protein function

  • Reconstitution parameters:

    • Lipid composition that mimics the native bacterial membrane

    • Protein-to-lipid ratio optimization

    • Reconstitution method selection (e.g., detergent dialysis vs. direct incorporation)

  • Functional validation:

    • Electrophysiological characterization using patch-clamp techniques

    • Pressure sensitivity measurements

    • Pharmacological profile determination (e.g., response to gadolinium)

How can researchers address potential challenges in expressing and characterizing Burkholderia proteins in heterologous systems?

Researchers facing challenges with Burkholderia proteins in heterologous systems can implement these strategies:

  • Overcoming expression barriers:

    • Use specialized expression strains designed for toxic or membrane proteins

    • Employ tightly regulated inducible promoter systems

    • Test expression at lower temperatures (e.g., 18-25°C) to improve protein folding

    • Consider cell-free expression systems for highly toxic proteins

  • Addressing protein solubility issues:

    • Screen multiple detergents for optimal extraction efficiency

    • Test various fusion partners beyond GST (e.g., MBP, SUMO) that may enhance solubility

    • Optimize buffer conditions including pH, salt concentration, and stabilizing additives

  • Confirming protein authenticity:

    • Validate protein identity through mass spectrometry

    • Confirm structural integrity through circular dichroism or limited proteolysis

    • Verify functionality through complementation of mscL-deficient bacterial strains

  • Adapting functional assays:

    • Develop fluorescence-based assays for high-throughput screening of channel activity

    • Implement liposome swelling assays as alternatives to patch-clamp for mechanosensitivity testing

    • Use osmotic shock survival assays to assess channel function in vivo

  • Controlling for species-specific factors:

    • Consider differences in membrane composition between E. coli and Burkholderia

    • Account for potential differences in post-translational modifications

    • Evaluate the impact of auxiliary proteins that might be required for full functionality

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.