Recombinant Burkholderia phymatum Lipoprotein signal peptidase (lspA)

What is the structural composition of Recombinant Burkholderia phymatum Lipoprotein Signal Peptidase (lspA)?

Recombinant Burkholderia phymatum Lipoprotein Signal Peptidase (lspA) is a full-length protein consisting of 166 amino acids with the UniProt ID B2JDY8. The complete amino acid sequence is: MSRTLSKPAGGSLAPWLGVAVIVILFDQLTKIAVAKVFAYGSSHAIAPFFNLVLVYNRGAAFSFLAMAGGWQRWAFTALGVAAAVLICYLLKRHGTQKMFCTALALIMGGAIGNVIDRLLYGHVIDFLDFHVGAWHWPAFNLADSAITIGAALLVFDELRRVRGAR . For research applications, the recombinant protein is commonly expressed with an N-terminal His-tag in E. coli expression systems to facilitate purification and downstream applications .

What alternative nomenclature exists for lspA in scientific literature?

When reviewing scientific literature about lspA, researchers should be aware of its multiple designations. The protein is alternatively known as Lipoprotein signal peptidase, Prolipoprotein signal peptidase, Signal peptidase II, and SPase II . In genomic studies focusing on Paraburkholderia phymatum, the gene may be referenced as Bphy_0573 . Understanding these alternative nomenclatures is essential for comprehensive literature searches and avoiding redundancy in research planning and publication.

What are the optimal storage conditions for maintaining recombinant lspA stability?

For optimal stability and activity retention, recombinant lspA should be stored at -20°C/-80°C upon receipt, with aliquoting recommended for multiple use scenarios to avoid repeated freeze-thaw cycles . The lyophilized protein powder is typically reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, addition of glycerol to a final concentration of 5-50% is recommended before aliquoting and storing at -20°C/-80°C . For short-term applications, working aliquots may be stored at 4°C for up to one week, though repeated freezing and thawing is not recommended as it significantly reduces protein stability and activity .

What expression systems are most effective for producing recombinant Burkholderia phymatum lspA?

E. coli expression systems have proven most effective for producing recombinant Burkholderia phymatum lspA with high yield and purity . The methodology typically involves cloning the full-length lspA gene (1-166 amino acids) into an expression vector that incorporates an N-terminal His-tag for subsequent purification. This approach enables the production of recombinant protein with purity levels exceeding 90% as determined by SDS-PAGE analysis . When designing expression protocols, researchers should consider that membrane proteins like lspA often require optimization of induction conditions, temperature, and host strain selection to maximize soluble protein production and minimize inclusion body formation.

What is the recommended protocol for reconstituting lyophilized lspA protein for experimental use?

The optimal reconstitution protocol for lyophilized lspA involves a systematic approach to maintain protein integrity. First, briefly centrifuge the vial containing lyophilized protein to ensure all material is at the bottom before opening . Then reconstitute the protein in deionized sterile water to achieve a concentration between 0.1-1.0 mg/mL . For long-term storage of the reconstituted protein, add glycerol to a final concentration of 5-50% (with 50% being the standard recommendation) and prepare multiple small-volume aliquots to avoid repeated freeze-thaw cycles . The reconstituted protein is typically maintained in a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0, which helps maintain protein stability and activity .

How can researchers assess the purity and activity of recombinant lspA preparations?

Purity assessment of recombinant lspA preparations typically employs SDS-PAGE analysis, with commercially available preparations generally exceeding 90% purity . For activity assessments, researchers should develop functional assays that evaluate the signal peptidase activity using synthetic peptide substrates that mimic the natural cleavage sites of prolipoprotein substrates. While standard activity assays for lspA are not explicitly described in the available literature, researchers could adapt methodologies from studies of other bacterial signal peptidases. When interpreting activity measurements, it's important to consider that activity can be affected by buffer composition, pH, temperature, and the presence of detergents that might be necessary to maintain the solubility of this membrane-associated protein.

How does Burkholderia phymatum lspA contribute to bacterial symbiosis with legumes?

As a signal peptidase in Paraburkholderia phymatum, lspA likely plays an important role in protein processing during the establishment of symbiotic relationships with legumes. P. phymatum STM815 has been identified as a rhizobial strain capable of nodulating numerous legume species, including agriculturally significant Phaseolus vulgaris (common bean) . The proper processing of lipoproteins by lspA may be critical for bacterial adaptation during the transition from free-living soil bacteria to symbiotic bacteroids within legume root nodules . This processing potentially affects the bacterial cell envelope composition, which undergoes significant changes during symbiosis establishment. While the specific role of lspA in this process is not explicitly detailed in the available literature, the protein's function in processing bacterial lipoproteins suggests its importance in bacterial adaptation to different environmental conditions encountered during symbiosis.

What role might lspA play in antibiotic resistance mechanisms in Burkholderia species?

While the specific role of lspA in antibiotic resistance isn't explicitly detailed in the provided literature, its function as a lipoprotein signal peptidase suggests potential involvement in mechanisms related to cell envelope integrity and modification. In the broader context of Burkholderia species, which are known for antimicrobial resistance, proteins involved in cell envelope maintenance can contribute to intrinsic resistance mechanisms . Particularly relevant is the fact that some Burkholderia species harbor Pen β-lactamases, which contribute significantly to antimicrobial resistance . The processing of lipoproteins by lspA could potentially affect the localization and function of proteins involved in antibiotic resistance, including efflux pumps or enzymes that modify antibiotics. This presents an important area for future research, particularly in developing targeted approaches to overcome antibiotic resistance in clinical isolates of Burkholderia.

What is the significance of lspA in the context of Burkholderia phymatum's competitive advantage in nodulation?

The competitive advantage of Paraburkholderia phymatum in nodulating various legume species may be partially attributed to proper processing of lipoproteins by lspA, particularly in the context of adaptation to different environmental conditions. Research has shown that P. phymatum demonstrates high competitiveness in infecting and nodulating the roots of several legumes, outcompeting other rhizobial strains under specific environmental conditions such as nitrogen limitation and low pH . The lipoprotein processing function of lspA could be crucial for the bacteria's adaptation to these conditions and for establishing effective plant-microbe interactions. Additionally, P. phymatum harbors two type VI Secretion Systems (T6SS-b and T6SS-3) that contribute to its interbacterial competitiveness both in vitro and during legume root infection . While the direct relationship between lspA and these secretion systems is not explicitly established in the literature, the proper processing of lipoproteins could potentially influence the assembly or function of these complex secretion systems.

How might structural comparisons between lspA from different bacterial species inform inhibitor design for antimicrobial development?

Structural analysis and comparison of lspA from different bacterial species, particularly pathogenic and symbiotic Burkholderia strains, could reveal crucial differences that might be exploited for targeted inhibitor design. The amino acid sequence of Burkholderia phymatum lspA (MSRTLSKPAGGSLAPWLGVAVIVILFDQLTKIAVAKVFAYGSSHAIAPFFNLVLVYNRGAAFSFLAMAGGWQRWAFTALGVAAAVLICYLLKRHGTQKMFCTALALIMGGAIGNVIDRLLYGHVIDFLDFHVGAWHWPAFNLADSAITIGAALLVFDELRRVRGAR) provides a foundation for structural modeling and comparison with homologs from other bacterial species . Methodologically, researchers could employ comparative protein modeling approaches combined with molecular dynamics simulations, similar to techniques applied to study dynamic differences in Pen β-lactamases . Such analysis could identify unique structural features or dynamic properties of lspA from pathogenic Burkholderia species that might be targeted by small-molecule inhibitors, potentially leading to novel antimicrobial strategies that selectively target pathogenic bacteria while sparing beneficial symbiotic species.

What are the key methodological challenges in studying the substrate specificity of lspA in Burkholderia phymatum?

Studying substrate specificity of lspA presents several methodological challenges that researchers must address. First, as a membrane-associated enzyme, maintaining lspA in its native conformation during purification and functional studies requires careful optimization of detergent conditions . Second, identifying physiological substrates requires comprehensive proteomic approaches to identify lipoproteins within Burkholderia phymatum that undergo lspA-mediated processing. Researchers might employ approaches combining genetic manipulation (e.g., lspA knockout or controlled expression systems) with quantitative proteomics to identify accumulating prolipoprotein substrates. Additionally, developing in vitro assays with sufficient sensitivity to measure the typically slow enzymatic activity of signal peptidases presents technical challenges. Researchers might address this by designing fluorogenic peptide substrates based on predicted cleavage sites of putative lipoprotein substrates in Burkholderia phymatum.

How could differential expression analysis of lspA under various environmental conditions inform our understanding of its role in bacterial adaptation?

Differential expression analysis of lspA under varied environmental conditions could provide valuable insights into its role in Burkholderia phymatum adaptation. A methodological approach might involve RNA-seq or quantitative RT-PCR analysis of lspA expression across conditions relevant to the bacterium's lifecycle, including free-living soil conditions, rhizosphere colonization, and bacteroid differentiation within root nodules . Similar to studies on Paraburkholderia phymatum T6SS expression, researchers could examine lspA expression in response to different carbon sources (such as citrate, glucose, succinate, or plant-derived dicarboxylates) and temperatures . Additionally, examining lspA expression in the presence of host plant factors, during seed germination, and within mature root nodules could reveal its potential role in symbiosis establishment. This research might be complemented by creating reporter gene fusions to the lspA promoter, allowing real-time monitoring of expression changes in response to environmental stimuli.

What potential roles might lspA play in the differential adaptation of Burkholderia phymatum to various host legume species?

Paraburkholderia phymatum exhibits an exceptionally broad host range, nodulating over 40 different Mimosa species and important papilionoid legumes like Phaseolus vulgaris . This prompts the question of how lspA might contribute to this remarkable adaptability. Researchers could investigate this through comparative transcriptomic and proteomic analyses of P. phymatum during interaction with different host legumes, examining whether lspA expression or the profile of lspA-processed lipoproteins varies between host species. Additionally, creating lspA mutants with altered expression levels or substrate specificity could help determine whether changes in lipoprotein processing affect host range or symbiotic efficiency. The methodological approach might include constructing lspA variants with site-directed mutations affecting catalytic activity or substrate recognition, then assessing their impact on nodulation and nitrogen fixation across different legume hosts. Such research could provide insights into whether lipoprotein processing contributes to the molecular dialogue between bacteria and host plants during symbiosis establishment.

What are common technical issues encountered when working with recombinant lspA and how can they be addressed?

When working with recombinant lspA, researchers frequently encounter technical challenges related to protein solubility, stability, and activity. As a membrane-associated enzyme, lspA can exhibit poor solubility in aqueous buffers, potentially leading to protein aggregation or precipitation . This challenge can be addressed by incorporating appropriate detergents or lipids that mimic the native membrane environment. Additionally, researchers should be cautious about repeated freeze-thaw cycles, which can significantly reduce protein activity . To minimize this issue, prepare multiple small-volume aliquots upon initial reconstitution and store with glycerol as a cryoprotectant . Another common challenge is maintaining consistent enzymatic activity across different preparations. This variability can be minimized by standardizing expression and purification protocols, carefully controlling buffer conditions, and including appropriate positive controls in activity assays. If difficulties persist with protein expression, alternative approaches such as fusion tags beyond the standard His-tag or codon optimization for the expression host might improve yield and solubility.

How can researchers effectively design experiments to elucidate the relationship between lspA activity and bacterial adaptation to different environmental conditions?

Designing experiments to connect lspA activity with bacterial adaptation requires a multifaceted approach combining genetic, biochemical, and physiological methods. Researchers should first create precisely controlled genetic systems, including inducible expression constructs and deletion mutants, to manipulate lspA levels in vivo . These genetic tools can then be used to assess phenotypic changes in response to relevant environmental stressors such as temperature shifts, pH changes, nutrient limitation, or exposure to plant-derived compounds . Complementary biochemical approaches might include developing in vitro assays to measure lspA activity under varying conditions, potentially using synthetic peptide substrates designed based on predicted natural substrates. Comparative proteomics of the bacterial cell envelope across different conditions and genetic backgrounds (wild-type versus lspA mutants) could reveal specific lipoproteins whose processing is condition-dependent. Finally, systems biology approaches integrating transcriptomic, proteomic, and phenotypic data might reveal regulatory networks connecting lspA function to specific adaptive responses.

What analytical techniques are most appropriate for characterizing the enzyme kinetics of recombinant lspA?

Characterizing the enzyme kinetics of recombinant lspA requires specialized analytical techniques that account for its membrane association and potentially slow catalytic rate. High-performance liquid chromatography (HPLC) or liquid chromatography-mass spectrometry (LC-MS) approaches can be employed to directly measure the cleavage of synthetic peptide substrates designed to mimic the signal sequence of natural lipoprotein substrates. These techniques allow for precise quantification of both substrates and products over time. Alternatively, researchers might develop fluorescence-based assays using peptide substrates with fluorophore-quencher pairs that change fluorescence properties upon cleavage. For detailed mechanistic studies, pre-steady-state kinetics using stopped-flow techniques could reveal important intermediates in the catalytic cycle. When analyzing kinetic data, researchers should consider that as a membrane protein, lspA activity might display complex dependencies on lipid or detergent composition, potentially deviating from standard Michaelis-Menten kinetics. Careful control experiments are essential to distinguish enzyme-specific effects from artifacts related to substrate solubility or detection limits.

How might CRISPR-Cas9 genome editing be applied to study lspA function in Burkholderia phymatum?

CRISPR-Cas9 genome editing offers powerful approaches for studying lspA function in Burkholderia phymatum through precise genetic manipulation. Researchers could develop methods to create clean deletions, point mutations in catalytic residues, or tag the native protein for localization studies without disrupting regulatory elements. The methodology would involve designing guide RNAs targeting specific regions of the lspA gene, along with appropriate repair templates for homology-directed repair to introduce desired modifications. For functional studies, researchers might create conditional knockdown systems using CRISPRi (CRISPR interference) to control lspA expression levels without complete gene deletion, which might be lethal if the protein is essential. Single-base editing variants of CRISPR-Cas9 could enable creation of specific amino acid substitutions to test structure-function hypotheses. These genetic tools would complement biochemical approaches using the recombinant protein and could be particularly valuable for studying lspA function during symbiotic interactions with legumes, where traditional genetic manipulations might be challenging .

What potential exists for developing lspA-targeted antimicrobials that selectively affect pathogenic Burkholderia without disrupting beneficial species?

The development of lspA-targeted antimicrobials with selectivity between pathogenic and beneficial Burkholderia species represents an intriguing research direction. Such selectivity would require identifying structural or functional differences between lspA enzymes from pathogenic species (such as B. pseudomallei and B. mallei) and beneficial symbionts like Paraburkholderia phymatum . Researchers could employ comparative structural biology approaches, including X-ray crystallography or cryo-electron microscopy, to resolve high-resolution structures of lspA from multiple Burkholderia species. These structural data, combined with molecular dynamics simulations similar to those used for studying Pen β-lactamases , could reveal species-specific binding pockets or dynamic properties that might be exploited for selective inhibitor design. High-throughput screening methodologies could then be developed to identify compounds that preferentially inhibit lspA from pathogenic species. The clinical relevance of such approaches is underscored by the significant contribution of Burkholderia species to difficult-to-treat infections and the global threat of antimicrobial resistance .