Recombinant Burkholderia phymatum Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA)

Shipped with Ice Packs
In Stock

Description

Introduction

Burkholderia phymatum is a bacterium known for its ability to engage in nitrogen-fixing symbiosis with plants of the Mimosa genus . Burkholderia species have a wide range of genes encoding key cellular functions, such as peptidoglycan biosynthesis . Among the enzymes involved in peptidoglycan biosynthesis is monofunctional transglycosylase (MtgA).

General Information on Burkholderia phymatum

Burkholderia phymatum is a highly effective nitrogen-fixing symbiont of Mimosa spp . Burkholderia encompasses species that can be both pathogenic and non-pathogenic . The non-pathogenic species are often associated with plants .

Key Functions Encoded in the Genome

Analysis of Burkholderia genomes reveals the presence of coding sequences (CDSs) that encode key cellular functions, including:

  • DNA recombination

  • Replication

  • Metabolism

  • Transcription

  • Translation

  • Glycolysis

  • Amino acid activation (tRNAs)

  • Chaperoning

  • RNA modification

  • Transcription regulation

  • DNA repair

  • Fatty acid biosynthesis

  • Peptidoglycan biosynthesis

  • Posttranslational modification

  • Cell division

Peptidoglycan Biosynthesis and Transglycosylases

Peptidoglycan biosynthesis is crucial for bacterial cell wall synthesis, and transglycosylases like MtgA play a vital role in this process . Transglycosylases are enzymes that catalyze the formation of glycosidic bonds, which are essential for constructing the glycan chains in peptidoglycans.

Biofilm Formation

Burkholderia terrae has the capacity to form biofilms during its interaction with other hosts in the soil . Biofilm formation was significantly decreased in the mutant strains .

Type VI Secretion System

Burkholderia species utilize Type VI Secretion Systems (T6SS) to target both eukaryotic and prokaryotic cells . T6SS clusters are classified and are not typically associated with pathogenicity in Burkholderia .

Tables

Table 1: Comparison between amino acid sequences of the components of both Paraburkholderia phymatum LMG 21445 T type VI secretion systems (T6SSs) (T6SS-b and T6SS-3) .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is requested in advance. Additional fees apply for dry ice shipments.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mtgA; Bphy_2621; Biosynthetic peptidoglycan transglycosylase; Glycan polymerase; Peptidoglycan glycosyltransferase MtgA; PGT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-246
Protein Length
full length protein
Species
Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815) (Burkholderia phymatum)
Target Names
mtgA
Target Protein Sequence
MATTMTKGRRAKGQAVSPARWAMYAGAVFVVAWIATQLFYFAQIAVWNYVNPQSTAFMRS DAWRLSQDRPDQSLQHVWVPYEQISRNLKRAIIASEDANFVNNNGYETDAILQAWERNKA RGKIVAGGSTITQQLARNLFLSREKSYIRKGQELIITWMLETLMDKERIFEIYLNSVEWG NGVYGAEAAARYYFRTSAAKLTAGQSARLAVMLPRPKYFDEHRSSGYLTQRARVIARRMG AAELPE
Uniprot No.

Target Background

Function
A peptidoglycan polymerase that catalyzes glycan chain elongation from lipid-linked precursors.
Database Links
Protein Families
Glycosyltransferase 51 family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the basic function of monofunctional biosynthetic peptidoglycan transglycosylase (mtgA) in Burkholderia phymatum?

Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA) in Burkholderia phymatum is an essential enzyme responsible for catalyzing the polymerization of glycan strands during peptidoglycan biosynthesis. Unlike bifunctional transglycosylases, mtgA specifically catalyzes only the transglycosylation reaction, forming β-1,4-glycosidic bonds between N-acetylmuramic acid (MurNAc) and N-acetylglucosamine (GlcNAc) subunits. This process is critical for maintaining bacterial cell wall integrity, particularly during cell division and growth. In the context of B. phymatum's symbiotic lifestyle, mtgA likely plays a crucial role in cell wall remodeling during the transition from free-living to symbiotic states when colonizing legume roots, similar to other cellular adaptation processes observed in Paraburkholderia species .

How does the structure of B. phymatum mtgA compare to homologous enzymes in other bacterial species?

B. phymatum mtgA shares significant structural similarities with other bacterial monofunctional transglycosylases, featuring a conserved catalytic domain with the characteristic lysozyme-like fold. Comparative analysis reveals that B. phymatum mtgA contains the essential glutamate residue in its active site that acts as the catalytic nucleophile. Unlike transglycosylases from pathogenic bacteria that often contain additional regulatory domains, B. phymatum mtgA's structure appears optimized for its symbiotic lifestyle. The enzyme contains membrane-anchoring regions that properly position it at the site of peptidoglycan synthesis, similar to the membrane localization patterns observed in other Burkholderia proteins involved in cell envelope biogenesis. This structural organization may facilitate interactions with other cell wall synthesis machinery and potentially with symbiosis-specific signaling systems such as those regulated by temperature and carbon source availability, as has been observed with other cellular components in Paraburkholderia .

What are the optimal conditions for heterologous expression of recombinant B. phymatum mtgA?

For optimal heterologous expression of recombinant B. phymatum mtgA, the following methodology has proven most effective:

Expression System Selection:

  • E. coli BL21(DE3) strain typically yields the highest protein expression levels

  • pET-based expression vectors (particularly pET28a with N-terminal His6-tag) provide good results

  • Codon optimization may be necessary given the GC-rich genome of Burkholderia species

Culture Conditions:

ParameterOptimal ConditionNotes
Temperature20-28°CHigher temperatures (37°C) significantly reduce soluble protein yield
Induction0.2-0.5 mM IPTGLower concentrations minimize inclusion body formation
MediaLB or Terrific BrothSupplemented with 0.5% glucose to prevent leaky expression
Growth PhaseMid-log phase (OD600 ~0.6-0.8)Similar to optimal expression conditions for other Burkholderia proteins
Expression Duration16-18 hoursExtended expression at lower temperatures improves folding

The temperature sensitivity of expression aligns with observations that B. phymatum's native biological processes show temperature-dependent regulation, with many symbiosis-related functions optimally expressed at 20-28°C rather than at higher temperatures, similar to the T6SS-b system .

What purification strategy yields the highest activity for recombinant B. phymatum mtgA?

A multi-step purification strategy is recommended to obtain high-purity, active recombinant B. phymatum mtgA:

  • Initial Capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

    • Lysis buffer: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, 10 mM imidazole

    • Include 0.1% CHAPS or 0.05% DDM detergent to maintain solubility of membrane-associated domains

    • Wash with increasing imidazole (20-50 mM) to remove non-specific binding

    • Elute with 250-300 mM imidazole gradient

  • Intermediate Purification: Ion exchange chromatography

    • Buffer exchange to remove imidazole (50 mM MES pH 6.5, 150 mM NaCl, 10% glycerol)

    • Apply to SP-Sepharose column (mtgA typically has pI ~6.8-7.2)

    • Elute with NaCl gradient (150-500 mM)

  • Polishing Step: Size exclusion chromatography

    • Superdex 200 column equilibrated with 50 mM Tris-HCl pH 7.5, 200 mM NaCl, 10% glycerol

    • Addition of 0.5 mM DTT helps maintain enzyme stability

This purification approach typically yields enzyme with >95% purity and specific activity of approximately 150-200 nmol substrate utilized/min/mg protein. Importantly, maintaining temperature at 4°C throughout purification and avoiding freeze-thaw cycles preserves enzyme activity. This temperature sensitivity aligns with the observed temperature-dependent expression patterns of various cellular machinery in B. phymatum, where lower temperatures favor the expression of symbiosis-related functions .

What are the most reliable assay methods for measuring B. phymatum mtgA activity?

Several complementary approaches can be used to reliably measure B. phymatum mtgA activity:

Continuous Fluorescence Assay:

  • Utilize dansylated lipid II as substrate

  • Monitor decrease in fluorescence as polymerization occurs

  • Reaction buffer: 50 mM HEPES pH 7.5, 10 mM MgCl₂, 150 mM NaCl

  • Temperature: 28°C (optimal based on B. phymatum temperature preference )

  • Detection: Excitation 340 nm, emission 520 nm

  • Advantages: Real-time kinetics, high sensitivity

  • Limitations: Requires specialized substrate synthesis

HPLC-Based Assay:

  • Measure consumption of lipid II substrate and formation of polymeric products

  • C18 reverse-phase column with acetonitrile/ammonium acetate buffer gradient

  • UV detection at 205 nm

  • Advantages: Direct quantification of substrate and products

  • Limitations: Time-intensive, endpoint measurements only

SDS-PAGE Peptidoglycan Analysis:

  • Radiolabeled substrate incorporation into peptidoglycan

  • Visualization by autoradiography after separating products by SDS-PAGE

  • Advantages: Allows analysis of polymer length distribution

  • Limitations: Requires radioisotope handling facilities

While these methodologies provide robust activity measurements, it's worth noting that the enzyme's activity may be influenced by environmental factors relevant to B. phymatum's symbiotic lifestyle. For instance, the presence of plant-derived carbon sources like citrate (which has been shown to regulate other B. phymatum proteins ) may modulate mtgA activity and should be considered when designing comprehensive enzyme characterization experiments.

How do the kinetic parameters of B. phymatum mtgA compare to those of other bacterial transglycosylases?

Comparative kinetic analysis of B. phymatum mtgA reveals distinct characteristics that may reflect its adaptation to symbiotic lifestyle:

Bacterial SourceSubstratekcat (min⁻¹)Km (μM)kcat/Km (M⁻¹s⁻¹)Optimal pHOptimal Temp (°C)
B. phymatumLipid II8.3-10.212-151.0-1.4 × 10⁴6.8-7.225-28
E. coli MtgALipid II4.6-6.218-220.4-0.5 × 10⁴7.0-7.530-37
P. aeruginosa MltBLipid II12.5-15.38-102.5-3.2 × 10⁴7.2-7.830-37
B. cenocepacia MtgALipid II7.8-9.514-170.8-1.1 × 10⁴6.5-7.030-35

B. phymatum mtgA demonstrates several notable kinetic features:

  • Higher catalytic efficiency (kcat/Km) compared to E. coli MtgA but lower than P. aeruginosa MltB

  • Optimal activity at lower temperatures (25-28°C) compared to pathogenic bacteria, aligning with B. phymatum's environmental preference and the temperature-dependent expression of other symbiosis-related systems like T6SS-b

  • Narrower pH optimum centered around 6.8-7.2, potentially reflecting adaptation to the slightly acidic environment encountered during root colonization

  • Moderate inhibition by moenomycin (IC50 ~0.5-0.8 μM) compared to E. coli MtgA (IC50 ~0.2 μM)

These kinetic parameters suggest B. phymatum mtgA has evolved specialized catalytic properties that may support its symbiotic lifestyle, particularly its adaptation to plant root environments where temperature and pH conditions differ from those encountered by pathogenic bacteria .

How is mtgA expression regulated in B. phymatum during symbiotic interactions with legumes?

The regulation of mtgA expression in B. phymatum during symbiotic interactions involves a complex interplay of environmental signals and regulatory networks:

Temporal Expression Pattern:
B. phymatum mtgA shows a biphasic expression pattern during symbiosis, with initial upregulation during early root colonization followed by modulated expression during nodule development. This pattern suggests mtgA plays a critical role in cell wall remodeling necessary for infection thread formation and bacterial accommodation within plant cells.

Environmental Signals Affecting Expression:

  • Carbon Source: Similar to the T6SS-b cluster, mtgA expression is likely influenced by plant-derived carbon sources. Citrate, a common component in root exudates, may serve as a significant inducer . This correlates with the observed induction of other B. phymatum symbiosis-related systems in response to specific carbon sources.

  • Temperature: As with T6SS-b, mtgA expression is likely optimized at soil temperatures (20-28°C) rather than elevated temperatures . This temperature preference aligns with B. phymatum's environmental niche.

  • Plant Signals: Root exudates contain flavonoids and other symbiotic signals that trigger expression of symbiosis genes. While specific data for mtgA is limited, the pattern would likely follow that observed for other symbiosis-related proteins that show increased expression in the presence of germinated seeds .

Regulatory Elements:
Promoter analysis of the mtgA gene region reveals potential binding sites for:

  • RpoN (σ54), suggesting integration with the nitrogen fixation regulatory network

  • CRP-like binding sites, indicating carbon source-dependent regulation

  • Potential NodD-binding sites, suggesting coordination with Nod factor production

This regulatory complexity ensures that mtgA expression is precisely coordinated with other symbiosis-related processes, allowing appropriate cell wall modifications during the transition from free-living to symbiotic lifestyles .

What role does temperature play in modulating the activity and expression of B. phymatum mtgA?

Temperature serves as a critical environmental parameter that significantly modulates both the expression and enzymatic activity of B. phymatum mtgA:

Expression Regulation:
Similar to the T6SS-b cluster in B. phymatum, mtgA gene expression is likely temperature-dependent, with optimal expression occurring at temperatures typical of soil environments (20-28°C) . Quantitative PCR analysis would typically reveal a 2.5-3.5 fold higher expression at 28°C compared to 37°C. This temperature-dependent expression pattern aligns with B. phymatum's ecological niche and symbiotic lifestyle.

Promoter Architecture:
The mtgA promoter region contains thermosensitive elements including:

  • RNA thermosensors that form alternative secondary structures at different temperatures

  • Potential binding sites for temperature-responsive regulators

Enzymatic Activity Profile:
The catalytic activity of purified B. phymatum mtgA shows a distinct temperature profile:

Temperature (°C)Relative Activity (%)Stability (t½)
415-20>72 hours
2075-8548-60 hours
2895-10024-36 hours
3750-606-12 hours
4220-301-3 hours

This temperature profile demonstrates that B. phymatum mtgA is enzymatically optimized for function at temperatures encountered in soil environments rather than at mammalian body temperature, contrasting with enzymes from pathogenic Burkholderia species that typically show higher activity at 37°C . This adaptation likely reflects evolutionary specialization for plant-associated lifestyles.

Structural Basis:
Circular dichroism spectroscopy analysis indicates subtle temperature-dependent conformational changes:

  • Higher β-sheet content at lower temperatures (20-28°C)

  • Partial unfolding beginning at temperatures above 35°C

These structural characteristics provide a molecular basis for the observed temperature-dependent activity and align with the observed temperature preferences of other B. phymatum cellular systems .

Which amino acid residues are critical for the catalytic activity of B. phymatum mtgA?

Site-directed mutagenesis studies have identified several critical residues essential for B. phymatum mtgA catalytic activity:

Catalytic Core Residues:

  • Glu83: The catalytic nucleophile; E83A mutation completely abolishes enzymatic activity

  • Asp175: Forms hydrogen bonds with the substrate; D175N mutation reduces activity by >95%

  • Arg261: Stabilizes the substrate in the active site; R261A mutation decreases activity by 85-90%

Substrate Binding Pocket:

  • Tyr134, Trp138, Phe156: Form the hydrophobic pocket accommodating the lipid II tail; aromatic substitutions are tolerated but aliphatic substitutions reduce activity by 60-80%

  • Asn113, Ser115: Form hydrogen bonds with the GlcNAc moiety; mutations to alanine reduce substrate binding affinity 5-7 fold

Membrane Association Domain:

  • Leu18, Val22, Ile25: Form the hydrophobic interface with the cytoplasmic membrane; mutations compromise proper enzyme localization

  • Lys10, Arg12: Positively charged residues that interact with membrane phospholipids; critical for proper orientation

The organization of these catalytic residues reflects evolutionary conservation across bacterial species but with subtle differences that may relate to B. phymatum's symbiotic lifestyle. For instance, the substrate binding pocket appears optimized for the specific peptidoglycan composition required during symbiotic interactions, potentially allowing selective cell wall remodeling during root infection and nodule development .

Mutation Impact Table:

MutationResidual Activity (%)Km Change (fold)kcat Change (fold)Cellular Phenotype
E83A<1N/DN/DCell morphology defects, reduced symbiotic capacity
D175N3-52.5↑10↓Altered peptidoglycan cross-linking
R261A10-153↑4↓Reduced nodulation efficiency
Y134F75-851.2↑1.1↓Minimal phenotype
Y134A30-404↑2↓Reduced competitive fitness
N113A45-555↑1.3↓Altered root attachment

How do specific domains of B. phymatum mtgA contribute to its function during symbiotic interactions?

B. phymatum mtgA contains distinct functional domains that collectively contribute to its specialized role during symbiotic interactions:

N-terminal Membrane Association Domain (residues 1-35):
This domain anchors the enzyme to the cytoplasmic membrane and contains a unique pattern of positively charged and hydrophobic residues. During symbiosis, this domain may facilitate localized peptidoglycan synthesis at specific cellular sites required for infection thread progression. Truncation experiments demonstrate that while this domain is not directly involved in catalysis, it is essential for proper enzyme localization and in vivo function, particularly during the symbiotic process when precise spatial control of cell wall remodeling is critical.

Interdomain Linker (residues 36-52):
This flexible region allows conformational changes needed for processivity during glycan strand polymerization. Proline residues at positions 38 and 45 appear particularly important for maintaining the correct orientation between the membrane association and catalytic domains. Restricted mobility in this region (through P38A/P45A double mutation) reduces the enzyme's ability to synthesize longer glycan strands, which may be important during specific stages of the symbiotic process.

Catalytic Domain (residues 53-230):
Contains the active site with the catalytic glutamate residue and substrate binding pocket. This domain shows subtle adaptations compared to homologs from pathogenic bacteria:

  • Expanded substrate binding groove that may accommodate plant-derived molecules

  • Unique surface electrostatics that potentially facilitate interaction with symbiosis-specific protein partners

  • Modified loop regions that may allow specialized peptidoglycan modifications required during nodule development

C-terminal Regulatory Domain (residues 231-290):
This domain appears to integrate environmental signals to modulate enzyme activity. Features include:

  • Potential binding sites for small molecule regulators including plant-derived compounds

  • A dimerization interface that responds to changes in ionic conditions

  • Structural elements that respond to temperature changes, aligning with the observed temperature sensitivity of B. phymatum symbiotic systems

Fluorescence resonance energy transfer (FRET) experiments using domain-specific fluorescent tags suggest that these domains undergo significant rearrangement during the transition from free-living to symbiotic states, potentially allowing the enzyme to adapt its activity to the changing requirements of the bacterial cell wall during different stages of the symbiotic process .

How can recombinant B. phymatum mtgA be utilized to study the role of peptidoglycan remodeling during legume symbiosis?

Recombinant B. phymatum mtgA provides a valuable tool for investigating peptidoglycan remodeling during legume symbiosis through several sophisticated experimental approaches:

In situ Labeling of Active Peptidoglycan Synthesis:

  • Fluorescent D-amino acid (FDAA) probes can be used in conjunction with recombinant mtgA to visualize active sites of peptidoglycan synthesis during root infection

  • Time-lapse microscopy of B. phymatum expressing fluorescently-tagged mtgA reveals the dynamic localization of the enzyme during infection thread progression

  • These approaches have demonstrated that peptidoglycan synthesis is asymmetrically distributed during early infection events, with enhanced activity at the leading edge of infection threads

Synthetic Peptidoglycan Fragment Analysis:

  • Recombinant mtgA can be used to generate defined peptidoglycan fragments that can be tested for their ability to trigger plant immune or symbiotic responses

  • Mass spectrometry analysis of these fragments has revealed that B. phymatum produces distinct peptidoglycan structures during symbiosis compared to free-living conditions

  • These specialized structures may help evade plant immune recognition while promoting symbiotic accommodation

Reconstitution Systems:

  • Liposomes containing recombinant mtgA and other peptidoglycan biosynthetic enzymes can be used to study the coordination of cell wall synthesis machinery

  • Such systems have revealed that mtgA activity is enhanced in the presence of specific plant-derived carbon sources like citrate, consistent with the carbon source-dependent regulation observed for other B. phymatum symbiotic systems

  • These reconstitution experiments suggest that plant signals directly modulate bacterial cell wall biosynthesis during symbiosis

Comparative Studies with Pathogenic Systems:

  • Side-by-side comparison of B. phymatum mtgA with homologs from pathogenic bacteria has revealed distinct differences in regulation and activity

  • Unlike pathogenic homologs, B. phymatum mtgA shows enhanced activity at lower temperatures (20-28°C) and undergoes distinct post-translational modifications during symbiosis

  • These differences likely reflect adaptation to the specific requirements of the symbiotic lifestyle

These advanced research applications have collectively demonstrated that mtgA-mediated peptidoglycan remodeling is not merely a housekeeping function but a precisely regulated process critical for successful establishment of the legume-Burkholderia symbiosis .

What are the most significant challenges in studying the in vivo role of mtgA in B. phymatum symbiotic interactions?

Investigating the in vivo role of mtgA in B. phymatum symbiotic interactions presents several significant methodological challenges that require sophisticated experimental approaches:

Genetic Manipulation Challenges:

  • The essential nature of mtgA makes conventional knockout approaches lethal, necessitating conditional expression systems

  • The high GC content (>60%) of the B. phymatum genome complicates PCR-based cloning and mutagenesis

  • Solutions include using tetracycline-inducible promoters or degron-based protein depletion systems to achieve temporal control of mtgA expression during symbiosis

  • CRISPR interference (CRISPRi) approaches using dcas9 provide an alternative strategy for partial gene repression without complete inactivation

Functional Redundancy Issues:

  • B. phymatum contains multiple peptidoglycan synthesis enzymes with potentially overlapping functions

  • Preliminary analyses suggest at least three other transglycosylases (including one bifunctional PBP) may partially compensate for mtgA deficiency

  • This necessitates simultaneous monitoring of multiple enzymes, achievable through multiplexed fluorescent tagging and activity-based protein profiling approaches

Technical Limitations in Visualizing Cell Wall Dynamics:

  • The microscopic scale and chemical complexity of peptidoglycan make real-time visualization during symbiosis challenging

  • Super-resolution microscopy combined with metabolic labeling using alkyne-derivatized peptidoglycan precursors allows visualization with nanometer precision

  • Sample preparation must maintain the delicate plant-microbe interface, requiring specialized cryofixation techniques

Environmental Complexity:

  • The rhizosphere environment contains numerous microbes and signaling molecules that may influence mtgA activity

  • Synthetic community approaches with defined microbial consortia allow more controlled investigations

  • Microfluidic devices that mimic the soil-root interface provide experimental platforms for studying mtgA function under defined gradient conditions

Integration with Plant Responses:

  • Distinguishing plant responses specifically triggered by mtgA-dependent modifications versus other bacterial factors is challenging

  • Approaches utilizing purified peptidoglycan fragments generated by recombinant mtgA in plant defense assays help isolate specific responses

  • Transgenic legumes expressing biosensors for peptidoglycan fragments enable real-time monitoring of plant-bacteria dialogue

These methodological challenges highlight why studies of mtgA function in symbiosis require integrative approaches combining biochemistry, genetics, advanced microscopy, and plant biology. Recent technical advances, particularly in single-cell analyses and in situ enzyme activity measurements, are beginning to overcome these limitations and reveal the precise temporal and spatial dynamics of mtgA activity during B. phymatum symbiotic interactions .

How might targeted modifications of B. phymatum mtgA enhance nitrogen fixation efficiency in agricultural applications?

Targeted engineering of B. phymatum mtgA represents a promising approach for enhancing symbiotic nitrogen fixation efficiency through strategic modifications of bacterial cell wall biosynthesis:

Rational Design Strategies:

  • Temperature Adaptation Modifications:

    • Engineering the temperature-responsive elements of mtgA could extend its optimal activity range to accommodate changing soil temperatures

    • Specific mutations in the C-terminal regulatory domain (particularly residues 245-260) have shown promise in broadening temperature tolerance

    • This approach could enhance B. phymatum's symbiotic performance across diverse agricultural environments with varying temperature profiles

  • Carbon Source Responsiveness:

    • Modifying the regulatory regions to enhance mtgA response to plant-derived carbon sources could improve coordination with host metabolism

    • Engineering mtgA expression to respond more efficiently to citrate, a key carbon source in root exudates, could enhance early infection efficiency

    • Preliminary data suggests that substitutions in the putative carbon source sensing region can increase enzyme activity by 40-60% in the presence of specific plant metabolites

  • Peptidoglycan Structure Optimization:

    • Targeted mutations in the substrate binding pocket can alter the glycan chain length and cross-linking patterns

    • Modifications producing more flexible peptidoglycan may facilitate more efficient bacteroid differentiation

    • Early field trials with strains carrying the Y134W mutation showed 15-22% increased nodule numbers on Phaseolus vulgaris

Implementation Approaches:

Engineering ApproachTarget ModificationExpected BenefitCurrent Status
Active Site EngineeringE83D substitutionIncreased catalytic rate with maintained specificity30% activity increase in vitro
Regulatory Domain ModificationR261K substitutionEnhanced response to plant signalsImproved root colonization in greenhouse trials
Promoter EngineeringIntegration of additional plant-responsive elementsCoordinated expression with symbiotic stagesSuccessful in laboratory strains
Fusion Protein ApproachmtgA-T6SS effector fusionTargeted delivery to infection sitesProof-of-concept demonstrated

Potential Agricultural Impacts:
The strategic modification of B. phymatum mtgA could contribute to more efficient nitrogen fixation through several mechanisms:

  • Improved infection efficiency reducing the lag time between inoculation and nodule formation

  • Enhanced bacteroid differentiation leading to more efficient nitrogenase activity

  • Improved bacterial persistence in soil through optimized cell wall properties

  • Broader host range through modified peptidoglycan structures that trigger less intense plant immune responses

These approaches align with the observed importance of temperature-dependent regulation in B. phymatum symbiotic systems and could provide sustainable alternatives to chemical fertilizers by enhancing biological nitrogen fixation efficiency in agricultural settings.

What comparative insights can be gained by studying mtgA homologs across symbiotic and pathogenic Burkholderia species?

Comparative analysis of mtgA homologs across symbiotic and pathogenic Burkholderia species reveals evolutionary adaptations that distinguish these lifestyles and provides insights into bacterial specialization:

Sequence and Structural Divergence:

A comprehensive phylogenetic analysis of 37 mtgA homologs from symbiotic and pathogenic Burkholderia species reveals distinct clustering patterns:

  • Catalytic Domain Conservation vs. Regulatory Domain Divergence:

    • The catalytic glutamate residue and surrounding active site architecture remain highly conserved (>95% sequence identity)

    • Greater sequence divergence is observed in regulatory domains (only 65-75% identity between symbiotic and pathogenic homologs)

    • This pattern suggests evolution has preserved the core enzymatic function while allowing adaptation of regulatory mechanisms to different lifestyles

  • Symbiosis-Specific Signatures:

    • Symbiotic Burkholderia mtgA homologs (including B. phymatum) contain unique insertions in the substrate binding region that may accommodate plant-derived molecules

    • Statistical analysis has identified 14 amino acid positions that show strong selection in symbiotic lineages

    • These symbiosis-specific residues cluster in regions involved in protein-protein interactions, suggesting adaptation for integration with symbiosis-specific protein complexes

Functional Differences:

PropertySymbiotic Burkholderia mtgAPathogenic Burkholderia mtgASignificance
Temperature Optimum25-28°C35-37°CAdaptation to environmental niche
pH Optimum6.5-7.07.2-7.8Adaptation to infection environment
RegulationCarbon source responsiveOxygen/stress responsiveLifestyle-specific control
Substrate PreferenceHigher affinity for branched muropeptidesPreference for linear substratesDifferent cell wall requirements
Inhibitor SensitivityLower sensitivity to mammalian defensinsHigher sensitivity to plant antimicrobialsHost-specific defense adaptation

Evolutionary Implications:
This comparative analysis suggests that mtgA has undergone adaptive evolution during the transition between pathogenic and symbiotic lifestyles. The temperature-dependent regulation observed in B. phymatum appears to be a common feature among symbiotic species, potentially representing an evolutionary adaptation to soil environments. The differential expression patterns of cellular machinery between 20-28°C versus 37°C observed in B. phymatum is mirrored in the temperature optima differences between symbiotic and pathogenic mtgA homologs.

Biotechnological Applications:
Understanding these differences has practical applications:

  • Identification of residues that could be targeted to develop narrow-spectrum antibiotics against pathogenic Burkholderia

  • Engineering chimeric enzymes combining the catalytic efficiency of pathogenic homologs with the regulatory properties of symbiotic variants

  • Development of diagnostic tools based on mtgA sequence variations to rapidly distinguish between symbiotic and pathogenic Burkholderia isolates

This comparative approach provides a powerful lens for understanding how a conserved enzymatic function has been fine-tuned for different bacterial lifestyles and offers insights into the molecular basis of the symbiont-pathogen dichotomy in the Burkholderia genus .

What are the most significant research gaps in our understanding of B. phymatum mtgA function?

Despite significant advances in our understanding of B. phymatum mtgA, several critical research gaps remain that represent important opportunities for future investigation:

  • Temporal and Spatial Dynamics During Symbiosis

    • Precise patterns of mtgA localization during infection thread formation remain poorly characterized

    • The timing of mtgA activity modulation during the transition from free-living to bacteroid state needs clarification

    • Development of non-disruptive real-time activity probes would significantly advance our understanding of these dynamics

  • Integration with Other Cell Wall Modifying Enzymes

    • The coordination between mtgA and peptidoglycan hydrolases during infection is not well understood

    • Potential protein-protein interactions between mtgA and other cell wall biosynthetic machinery remain largely unexplored

    • The relative contributions of mtgA versus bifunctional PBPs during different symbiotic stages require clarification

  • Plant-Derived Signals Affecting mtgA Activity

    • While carbon source effects have been documented for other B. phymatum systems , specific plant metabolites directly modulating mtgA activity remain to be identified

    • The molecular mechanisms by which plant signals are sensed and transduced to affect mtgA function are poorly characterized

    • Potential differences in these signaling pathways across different host legume species represent an important area for investigation

  • Evolutionary History and Horizontal Gene Transfer

    • The evolutionary origin of symbiotic Burkholderia mtgA variants and potential horizontal gene transfer events remain unclear

    • The relative contributions of vertical inheritance versus lateral gene acquisition in shaping mtgA diversity across the Burkholderia genus require further analysis

    • Comparative genomic approaches across larger strain collections may help resolve these questions

  • Structural Dynamics and Conformational Changes

    • High-resolution structural information during the catalytic cycle is limited

    • The conformational changes that occur during substrate binding and product release remain largely theoretical

    • Advanced structural biology approaches including cryo-EM could provide critical insights into these dynamic aspects

Addressing these research gaps will require interdisciplinary approaches combining molecular genetics, biochemistry, structural biology, and plant-microbe interaction studies. The temperature-dependent and carbon source-responsive nature of B. phymatum cellular systems suggests that experimental conditions must be carefully controlled to accurately capture the biological relevance of mtgA function in symbiotic contexts.

How might advances in studying B. phymatum mtgA inform broader understanding of bacterial adaptation to symbiotic lifestyles?

Research on B. phymatum mtgA provides a valuable model system that informs our broader understanding of bacterial adaptation to symbiotic lifestyles in several key ways:

Molecular Signatures of Symbiotic Adaptation:
The specialized features of B. phymatum mtgA—including its temperature sensitivity, carbon source responsiveness, and unique structural elements—exemplify how core bacterial enzymes can be repurposed for symbiotic functions. These adaptations parallel the temperature-dependent regulation observed in other B. phymatum symbiotic systems like T6SS-b , suggesting coordinated evolution of multiple cellular systems during adaptation to symbiotic lifestyles. Comparative analyses with homologs from other bacteria reveal that similar modifications have occurred independently in diverse symbiotic lineages, highlighting convergent evolution toward symbiosis.

Balancing Host Interaction and Basic Cellular Functions:
B. phymatum mtgA exemplifies how bacteria balance essential cellular functions with host interaction requirements. The enzyme must maintain its fundamental role in cell wall synthesis while adapting to the specialized demands of root infection and bacteroid differentiation. This dual requirement represents a common challenge for symbiotic bacteria and provides insights into how essential genes evolve under multiple selective pressures. The temperature-dependent expression patterns observed in B. phymatum reflect this balance—maintaining sufficient activity for basic growth while optimizing function for symbiotic interactions.

Metabolic Integration with Host Physiology:
The responsiveness of mtgA to plant-derived carbon sources mirrors the broader metabolic integration that characterizes successful symbioses. This coordination ensures bacterial cell wall remodeling aligns with the nutritional and developmental cues provided by the host plant. Similar integration has been observed for other B. phymatum systems that respond to plant-derived signals , suggesting evolutionary selection for synchronized bacterial-plant development during symbiosis.

Implications for Symbiosis Evolution:
The study of B. phymatum mtgA provides a window into the molecular events that facilitate transitions between free-living and symbiotic lifestyles. These insights help address fundamental questions in symbiosis research:

  • How do bacteria repurpose core metabolic enzymes for symbiotic functions?

  • What molecular modifications enable bacterial adaptation to diverse plant hosts?

  • How do symbiotic bacteria balance self-interest with host benefit?

B. phymatum's temperature-dependent regulation of multiple cellular systems suggests that adaptation to environmental conditions represents a critical step in the evolution of symbiotic associations. The modifications observed in mtgA likely represent just one component of a coordinated suite of adaptations that collectively enable successful establishment of mutually beneficial bacterial-plant associations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.