Recombinant Burkholderia phymatum NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prefer to ship the format currently in stock, we can accommodate specific requests. Please indicate your desired format when placing your order, and we will make every effort to fulfill your needs.
Lead Time
Delivery time may vary based on the purchase method and location. Please consult your local distributor for specific delivery times.
Note: All proteins are shipped with standard blue ice packs. For dry ice shipping, please contact us in advance as additional charges apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference point.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. To maintain optimal product integrity, avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
We will prioritize developing a specific tag type if you have provided a requirement. Please inform us of your desired tag type for consideration.
Synonyms
nuoK; Bphy_1999; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815) (Burkholderia phymatum)
Target Names
nuoK
Target Protein Sequence
MLSLAHYLVLGAILFAISIVGIFLNRRNVIIILMAIELMLLAVNTNFVAFSHYLGDVHGQ IFVFFVLTVAAAEAAIGLAILVTLFRSLDTINVEDLDQLKG
Uniprot No.

Target Background

Function
NDH-1 acts as an electron shuttle, transferring electrons from NADH to quinones within the respiratory chain, via FMN and iron-sulfur (Fe-S) centers. In this species, ubiquinone is believed to be the enzyme's immediate electron acceptor. This process couples the redox reaction with proton translocation, where four hydrogen ions are translocated across the cytoplasmic membrane for every two electrons transferred. This mechanism effectively conserves redox energy by creating a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Burkholderia phymatum NADH-quinone oxidoreductase subunit K and its role in bacterial metabolism?

The NADH-quinone oxidoreductase subunit K (nuoK) in Burkholderia phymatum is a critical component of the bacterial H+-translocating NADH:quinone oxidoreductase (NDH-1) complex. This enzyme catalyzes electron transfer from NADH to quinone coupled with proton pumping across the cytoplasmic membrane. The NuoK subunit is one of seven hydrophobic subunits in the membrane domain and is the bacterial counterpart of the mitochondrial ND4L subunit. It contains three transmembrane segments (TM1-3) and plays a crucial role in the energy-transducing mechanism of the NDH-1 complex . In B. phymatum, this enzyme is particularly important for energy metabolism during both free-living and symbiotic stages of its lifecycle, contributing to the bacterium's ability to establish and maintain nitrogen-fixing nodules with legume hosts .

How does the genomic organization of nuoK contribute to understanding its function in Burkholderia phymatum?

The nuoK gene is part of the nuo operon in the Burkholderia phymatum genome, which encodes the complete NDH-1 complex. B. phymatum possesses a large 8,676,562 bp genome composed of two chromosomes (3,479,187 and 2,697,374 bp), a megaplasmid (1,904,893 bp), and a plasmid hosting symbiotic functions (595,108 bp) . Understanding the genomic context of nuoK helps explain how it is regulated in coordination with other components of the respiratory chain. The gene's conservation across bacterial species and its strategic location within the operon reflects its evolutionary importance. Researchers investigating nuoK should consider this genomic organization, as it provides insights into potential regulatory elements that control nuoK expression under different physiological conditions, particularly during the transition from free-living to symbiotic lifestyles.

What are the optimal protocols for cloning and expressing recombinant nuoK from Burkholderia phymatum?

For successful cloning and expression of recombinant nuoK from Burkholderia phymatum, researchers should consider the following methodological approach:

  • Gene Amplification: Design primers that encompass the complete nuoK coding sequence, including any necessary restriction sites for subsequent cloning. When designing primers, consider codon optimization based on the expression host.

  • Expression System Selection: For membrane proteins like NuoK with multiple transmembrane domains, specialized expression systems such as E. coli C41(DE3) or C43(DE3) strains are recommended as they are engineered for membrane protein expression.

  • Vector Selection: Utilize vectors containing solubility-enhancing tags (such as MBP or SUMO) positioned at the N-terminus to improve protein folding and solubility. A C-terminal His-tag facilitates purification while minimizing interference with transmembrane domain insertion.

  • Expression Conditions: Optimize by testing multiple temperatures (18-30°C), inducer concentrations, and induction times. Lower temperatures (18-20°C) with extended expression periods (16-24 hours) often yield better results for membrane proteins.

  • Protein Extraction and Purification: Employ gentle detergent-based extraction (e.g., n-dodecyl β-D-maltoside or digitonin) followed by affinity chromatography using the incorporated tag.

The success of expression should be verified through activity assays similar to those described for NDH-1, including dNADH-K3Fe(CN)6 reductase activity, dNADH-DB reductase activity, and dNADH-UQ1 reductase activity measured at various pH values .

How can researchers accurately measure the activity of recombinant nuoK, and what controls are essential for reliable results?

Accurately measuring the activity of recombinant nuoK requires specialized assays that assess both electron transfer and proton translocation functions. The following methodological approach is recommended:

Electron Transfer Activity Assays:

  • dNADH-K3Fe(CN)6 Reductase Activity: Perform at 30°C with 80 μg of protein/ml in 10 mM potassium phosphate (pH 7.0), 1 mM EDTA containing 10 mM KCN, and 1 mM K3Fe(CN)6. Preincubate samples for 1 minute before adding 150 μM dNADH. Monitor signal at 420 nm .

  • dNADH-DB Reductase Activity: Replace K3Fe(CN)6 with 50 μM DB as electron acceptor and monitor signal at 340 nm in the same buffer .

  • dNADH-UQ1 Reductase Activity: Use 50 μM UQ1 as electron acceptor. Add Capsaicin-40 to inhibit the reaction for control measurements .

Proton Translocation Assays:

  • Monitor NDH-1 proton pump activity by ACMA fluorescence quenching using 200 μM dNADH as substrate .

Essential Controls:

  • Negative control: heat-denatured enzyme preparation

  • Positive control: wild-type NuoK preparation

  • Inhibitor control: specific inhibitors like capsaicin-40

  • Substrate specificity control: vary electron acceptors (DB, UQ1, etc.)

  • pH dependence: perform assays at multiple pH values (6.0-8.0) to establish optimal conditions

All measurements should be performed 2-3 times to ensure reproducibility. For precise quantification, use extinction coefficients of ε340 = 6.22 mM-1 cm-1 for dNADH and ε420 = 1.00 mM-1 cm-1 for K3Fe(CN)6 .

Which amino acid residues in nuoK are critical for its function, and how should researchers approach site-directed mutagenesis studies?

Based on existing research, several critical amino acid residues in nuoK have been identified as essential for function. The following table summarizes these key residues and their functional significance:

ResidueLocationConservationEffect of MutationFunctional Significance
Glu-36TM2Perfectly conservedComplete loss of NDH-1 activities when mutated to AlaCritical for energy coupling mechanism
Glu-72TM3Almost perfectly conservedPartial but significant loss of activities when mutated to Ala or GlnImportant for energy transduction
Arg-25Loop-1 (between TM1-TM2)Highly conservedDrastic effect on energy transducing activities when mutatedCrucial for structural integrity and function
Arg-26Loop-1 (between TM1-TM2)Highly conservedDrastic effect on energy transducing activities when mutatedCrucial for structural integrity and function
Asn-27Loop-1 (between TM1-TM2)ConservedAffects energy transducing activitiesImportant for loop-1 functionality

For effective site-directed mutagenesis studies, researchers should:

  • Create Targeted Substitutions: Replace conserved residues with amino acids of different properties (e.g., charge, size, hydrophobicity). For example, substitute Glu-36 with Asp to maintain charge but alter side chain length, or with Gln to maintain structure but remove charge.

  • Consider Positional Shifts: Relocate key residues within the same transmembrane segment to assess the importance of their precise positioning. Previous research showed that shifting Glu-36 to positions 32, 38, 39, and 40 (located in the same helix phase) resulted in retention of significant NDH-1 activity .

  • Test Double Mutations: Generate combinations of mutations to investigate potential cooperative effects between residues.

  • Assess Functional Consequences: For each mutant, conduct comprehensive activity assays including electron transfer (dNADH oxidase, dNADH-DB reductase) and proton pumping (ACMA fluorescence quenching) to fully characterize the functional impact.

  • Integrate Structural Information: Interpret results in the context of available structural data to develop mechanistic models of how these residues contribute to nuoK function.

How do transmembrane segments in nuoK contribute to proton translocation, and what experimental approaches best characterize these mechanisms?

The three transmembrane segments (TM1-3) of nuoK play distinct roles in proton translocation, with current evidence suggesting a complex mechanism involving charged residues strategically positioned within these helices. The following experimental approaches are recommended to characterize these mechanisms:

  • Cysteine Scanning Mutagenesis: Systematically replace residues throughout each transmembrane segment with cysteine, then perform accessibility studies using membrane-permeable and -impermeable sulfhydryl reagents to map the transmembrane topology and identify residues exposed to the proton translocation pathway.

  • pH-Dependent Cross-Linking Studies: Introduce pairs of cysteines at strategic positions and assess pH-dependent conformational changes through disulfide bond formation, which can reveal dynamic structural rearrangements during proton translocation.

  • Hydrogen-Deuterium Exchange Mass Spectrometry: Apply this technique to identify regions of nuoK that undergo conformational changes during the catalytic cycle, potentially revealing segments involved in proton uptake and release.

  • Electrophysiological Measurements: Reconstitute purified recombinant nuoK or the entire NDH-1 complex into proteoliposomes and perform patch-clamp studies to directly measure proton currents in response to substrates and inhibitors.

  • Molecular Dynamics Simulations: Complement experimental data with computational modeling to predict proton pathways through the transmembrane domains and identify water molecules or amino acid side chains that might participate in proton wire mechanisms.

Research has shown that Glu-36 in TM2 and Glu-72 in TM3 are particularly important, with Glu-36 being essential for activity . The proximity of these residues in adjacent transmembrane helices suggests they may form part of a proton translocation pathway. Additionally, the short cytoplasmic loop (loop-1) connecting TM1 and TM2, containing Arg-25, Arg-26, and Asn-27, is crucial for energy transduction, possibly by facilitating conformational changes necessary for coupling electron transfer to proton translocation .

How does nuoK from Burkholderia phymatum compare to homologous subunits in other bacterial species, and what does this reveal about evolutionary conservation?

Comparative analysis of nuoK from Burkholderia phymatum with homologous subunits in other bacterial species reveals important insights about evolutionary conservation and functional adaptation:

Despite nuoK being one of the least conserved subunits of NDH-1 across species, certain key features show remarkable conservation . The two glutamic acid residues, Glu-36 in TM2 and Glu-72 in TM3, display different degrees of conservation: Glu-36 is perfectly conserved across all species, while Glu-72 is almost perfectly conserved . This differential conservation pattern suggests that Glu-36 plays an absolutely essential role in the core mechanism of the enzyme, while Glu-72 may have a supporting role that allows some variability.

The conservation patterns of nuoK can be correlated with the ecological niche and metabolic versatility of different bacterial species. In B. phymatum, which can establish nitrogen-fixing symbiosis with legumes, the efficiency of energy conservation through proton translocation may be particularly important during the energy-intensive nitrogen fixation process, potentially explaining any species-specific adaptations in the nuoK sequence.

What role does nuoK play in the ecological success of Burkholderia phymatum, particularly in its competitive nodulation ability?

The nuoK subunit likely contributes significantly to the ecological success of Burkholderia phymatum, particularly to its remarkable competitive advantage in nodulating several legume hosts. The following aspects highlight this relationship:

  • Energy Efficiency: As a component of the NDH-1 complex, nuoK contributes to efficient energy conservation through proton translocation. This energy efficiency may be critical for B. phymatum's competitive nodulation ability, as it has been shown to be one of the most competitive strains in nodulating papilionoid legumes (bean, cowpea, and siratro) .

  • Adaptation to Symbiotic Environment: The symbiotic environment within legume nodules presents unique bioenergetic challenges, including microaerobic conditions and specific carbon source availability. The nuoK subunit may have specialized adaptations that optimize NDH-1 function under these conditions, contributing to B. phymatum's competitive success.

  • Support for Nitrogen Fixation: Nitrogen fixation is an energy-intensive process. B. phymatum's competitive advantage in nodulation correlates with its high motility, increased exopolysaccharide production, and ability to outcompete other strains . The efficient energy conversion facilitated by a well-functioning NDH-1 complex (including nuoK) likely supports these energy-demanding competitive traits.

  • Host Range Determination: B. phymatum displays a broad host range, nodulating multiple legume genera and species beyond its frequent association with Mimosa pudica . The energetic efficiency provided by the respiratory chain, including nuoK's contribution, may enable the metabolic flexibility required to adapt to diverse host environments.

Research investigating nuoK mutants in the context of symbiotic performance could provide valuable insights into how this subunit contributes to the competitive success of B. phymatum in various ecological niches.

How can recombinant nuoK be utilized to develop inhibitors targeting respiratory chains in pathogenic bacteria, and what experimental approaches would guide this research?

Developing inhibitors targeting nuoK and related respiratory chain components in pathogenic bacteria represents a promising avenue for antimicrobial research. The following experimental approaches would guide this research:

  • Structure-Based Drug Design: Utilize structural information from recombinant nuoK to identify potential binding pockets, focusing on regions that are conserved in pathogenic bacteria but distinct from mammalian homologs. In silico molecular docking studies can screen compound libraries for potential binding to these sites.

  • Functional Assays for Inhibitor Screening: Develop high-throughput assays based on the activity measurements described earlier (dNADH oxidase, dNADH-DB reductase, proton pumping) to screen candidate compounds for inhibitory activity against recombinant nuoK or reconstituted NDH-1 complexes.

  • Selectivity Profiling: Compare inhibition profiles against recombinant nuoK from diverse bacterial species, including pathogens and beneficial symbionts like B. phymatum, to identify compounds with selectivity for pathogenic species.

  • Resistance Mechanism Studies: Generate resistant mutants through directed evolution approaches and sequence them to identify potential resistance mechanisms, informing iterative inhibitor design.

  • Whole-Cell Validation: Test promising inhibitors in bacterial cultures to confirm they can access the target in living cells and demonstrate antibacterial activity.

This research could leverage the knowledge that certain specific residues (Glu-36, Glu-72, Arg-25, Arg-26) are critical for nuoK function , potentially targeting these regions for inhibitor design. Importantly, while B. phymatum itself is beneficial in agricultural contexts, understanding its nuoK could provide a model for targeting homologous proteins in related pathogenic Burkholderia species.

What are the most significant challenges in working with recombinant nuoK, and how can researchers overcome them?

Working with recombinant nuoK presents several significant challenges that researchers should anticipate and address:

  • Membrane Protein Expression and Stability:

    • Challenge: As a membrane protein with three transmembrane segments, nuoK is difficult to express in functional form and prone to aggregation and misfolding.

    • Solution: Utilize specialized expression systems designed for membrane proteins (E. coli C41/C43 strains, cell-free systems), optimize detergent selection for extraction (test a panel including DDM, LMNG, and digitonin), and consider fusion tags that enhance solubility. Expression at lower temperatures (16-20°C) with longer induction times often improves proper folding.

  • Functional Characterization Outside the NDH-1 Complex:

    • Challenge: nuoK normally functions as part of the larger NDH-1 complex, making it difficult to assess its function in isolation.

    • Solution: Consider co-expression with interacting subunits (particularly NuoA and NuoJ) to maintain native interactions. Alternatively, reconstitute purified nuoK into liposomes or nanodiscs to provide a membrane-like environment for functional studies.

  • Structural Analysis:

    • Challenge: Small membrane proteins like nuoK are challenging targets for structural determination.

    • Solution: Employ complementary structural approaches, including cryo-EM of the whole NDH-1 complex, NMR studies of isolated nuoK in detergent micelles, and computational modeling informed by cross-linking and mutagenesis data.

  • Distinguishing Direct vs. Indirect Effects in Mutagenesis Studies:

    • Challenge: Mutations in nuoK may affect activity directly or indirectly through impacts on complex assembly or stability.

    • Solution: Complement activity assays with biophysical techniques (size-exclusion chromatography, blue native PAGE) to assess complex integrity. Include controls that distinguish between expression/stability defects and specific catalytic impairments.

  • Physiological Relevance of In Vitro Findings:

    • Challenge: Bridging the gap between in vitro biochemical findings and physiological relevance in intact bacteria.

    • Solution: Validate key findings by creating corresponding chromosomal mutations in B. phymatum and assessing their impact on growth and symbiotic performance under various conditions, including competition assays with other rhizobial strains.

By anticipating these challenges and implementing appropriate methodological solutions, researchers can substantially enhance the success and impact of their investigations into recombinant nuoK from Burkholderia phymatum.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.