Recombinant Burkholderia phymatum Probable ubiquinone biosynthesis protein UbiB (ubiB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ubiB; Bphy_0377; Probable protein kinase UbiB; Ubiquinone biosynthesis protein UbiB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-527
Protein Length
full length protein
Species
Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815) (Burkholderia phymatum)
Target Names
ubiB
Target Protein Sequence
MRFLRFLKIFFTVIRFGLDEMMLSRVNDRRVRLLLRITTIGRKFDQPPGVRLRLALESLG PIFVKFGQVLSTRRDLLRPDIATELAKLQDQVPPFDSAVAIAIIEKSLGAPVDTIFDDFE RVPVASASIAQVHFATLKIGQHAGKQVAVKVLRPNMLPVIDSDLALLRDIAVWAERLWAD GKRLKPREVVAEFDKYLHDELDLMREAANGSQLRRNFAGLDLLLVPEMYWEYCTANVLVM ERMVGVPISQVDTLRVAGVDIPKLAREGVEIFFTQVFRDGFFHADMHPGNIQVSLDPAHF GRYIALDFGIIGALSDFDKNYLAQNFLAFFKRDYHRVATLHLESGWVPATTRVEELESAI RAVCEPYFDRALKDISLGQVLMRLFSTSRRFNVEIQPQLVLLQKTMLNVEGLGRSLDPEL DLWKTAKPYLERWMNEQIGAKGWYERLKIEAPQWSKTLPQLPRLIHHVLAQRHDAQQRGI NDETIRQILLEQKRTNRLLQGLLMFGVAVGVGAVLARAWLAIAYGGY
Uniprot No.

Target Background

Function
This protein is likely a protein kinase regulator of UbiI activity, which is involved in the aerobic biosynthesis of coenzyme Q (ubiquinone).
Database Links
Protein Families
ABC1 family, UbiB subfamily
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is Burkholderia phymatum and what ecological role does it play?

Burkholderia phymatum is a beta-proteobacterium that plays a crucial role in nitrogen-fixing symbiosis with various leguminous plants, particularly species from the Mimosa genus. This bacterium has been identified from root nodules of Phaseolus vulgaris (common bean) grown in Moroccan soils and can form nitrogen-fixing nodules on several plant species including Mimosa, Acacia, and Prosopis . As a beta-rhizobium (β-rhizobium), B. phymatum contributes significantly to agricultural benefits by reducing the need for nitrogen fertilizers through its symbiotic relationship with legumes . The complete genome sequence of B. phymatum strain STM815T has revealed insights into its genetic structure and functional gene classes related to symbiotic activities .

Methodologically, researchers can isolate B. phymatum from root nodules using standard bacteriological techniques involving surface sterilization of nodules, crushing, and culturing on yeast extract mannitol agar with Congo red. Identification can be confirmed through 16S rRNA gene sequencing, protein profiling using SDS-PAGE, and physiological characterization using API 20 NE and API 50 CH tests .

What is the function of ubiquinone in bacterial metabolism?

Ubiquinone (coenzyme Q) serves as an essential electron carrier in the respiratory chain of many aerobic and facultatively anaerobic bacteria. It functions as:

  • An electron transport component in the membrane respiratory chain, facilitating energy generation

  • A terminal electron acceptor in aerobic respiration

  • A co-substrate in various biosynthetic pathways

  • A contributor to bacterial adaptation across varying oxygen conditions

Ubiquinone biosynthesis is crucial for optimizing bacterial metabolism across the entire oxygen range, from aerobic to anaerobic conditions . Bacteria with both O2-dependent and O2-independent ubiquinone biosynthesis pathways possess a significant metabolic advantage that allows them to colonize environments with large O2 gradients or fluctuating O2 levels. This metabolic flexibility has been linked to antibiotic resistance, virulence, and the capacity to develop in complex ecosystems such as the microbiota .

How does the UbiB protein contribute to ubiquinone biosynthesis?

The UbiB protein is a probable ubiquinone biosynthesis protein in B. phymatum that likely participates in the biosynthetic pathway of ubiquinone. While the specific function of UbiB in B. phymatum isn't explicitly detailed in the available research, insights from related systems suggest it plays a role in the hydroxylation reactions required for ubiquinone synthesis.

In ubiquinone biosynthesis pathways, hydroxylation reactions are critical steps in modifying the aromatic ring of precursor molecules. In related systems, these reactions may be catalyzed by proteins containing iron-sulfur clusters, such as the UbiU-UbiV complex identified in E. coli, which forms a heterodimer with each protein binding a 4Fe-4S cluster via conserved cysteines that are essential for activity . UbiB likely participates in similar reactions, potentially functioning in both O2-dependent and O2-independent contexts to ensure ubiquinone production across varying environmental conditions.

What are the most effective protocols for expressing recombinant B. phymatum UbiB protein?

For expressing recombinant B. phymatum UbiB protein, researchers should consider a multi-step approach:

Expression System Selection:
While E. coli remains the primary expression system for heterologous proteins, consider that B. phymatum proteins may require specialized conditions. For UbiB, which likely contains membrane-associated domains, expression systems capable of proper membrane protein folding (such as C41(DE3) or C43(DE3) E. coli strains) are recommended.

Vector Design Considerations:

  • Include an appropriate affinity tag (His6, GST, or MBP) for purification

  • Place the tag at the C-terminus if N-terminal function is critical

  • Incorporate a TEV protease cleavage site for tag removal

  • Include appropriate promoters (T7 for high expression; araBAD for tunable expression)

Expression Optimization Protocol:

  • Transform expression construct into selected host cells

  • Test expression at various temperatures (18°C, 25°C, 30°C, 37°C)

  • Evaluate different induction conditions (IPTG concentration range: 0.1-1.0 mM)

  • Assess expression in various media (LB, TB, minimal media with supplements)

  • Determine optimal expression time (4h, 8h, overnight)

Membrane Protein-Specific Considerations:
For UbiB specifically, consider detergent screening for solubilization post-expression, as it likely has membrane-associated domains. A systematic approach testing various detergents (DDM, LDAO, OG, etc.) at different concentrations is recommended for optimal protein extraction and stability.

Recent advances in recombineering systems for Burkholderia species may provide alternative approaches for expressing UbiB in its native context. The development of lambda phage Red proteins (Redα/Redβ/Redγ) and Rac prophage RecE/RecT protein systems offers potentially powerful tools for precise genetic manipulation .

What techniques are most reliable for assessing UbiB enzymatic activity in vitro?

Assessing UbiB enzymatic activity requires specialized techniques that account for its probable role in ubiquinone biosynthesis:

Substrate Preparation:

  • Synthesize or obtain 4-hydroxybenzoate and polyprenyl diphosphate precursors

  • Prepare radiolabeled substrates (14C-labeled) for sensitive detection

  • Develop LC-MS/MS methods to detect ubiquinone intermediates

Activity Assay Components:

  • Purified recombinant UbiB protein (10-100 μg/ml)

  • Substrate mixture (50-200 μM)

  • Buffer system (pH 7.0-8.0) containing divalent cations (Mg2+, Mn2+)

  • Electron donors (NADH, NADPH)

  • Membrane fraction or artificial lipid environment

  • Potential cofactors (flavins, iron-sulfur cluster components)

Analytical Methods:

  • HPLC-based detection of reaction products with UV or fluorescence detection

  • LC-MS/MS for precise identification of intermediates and products

  • Oxygen consumption measurement using oxygen electrodes for O2-dependent reactions

  • EPR spectroscopy to assess iron-sulfur cluster involvement in catalysis

Complementary Approaches:
For systems where direct activity measurement is challenging, complementation assays in UbiB-deficient bacterial strains can provide functional evidence. Growth restoration or ubiquinone production in these systems indicates functional activity of the recombinant protein.

Given the likely similarity to other ubiquinone biosynthesis systems, researchers should consider that UbiB may function as part of a complex with other proteins (similar to the UbiU-UbiV heterodimer system identified in E. coli) , necessitating reconstitution of multiple components for full activity assessment.

What are the common challenges when working with recombinant B. phymatum proteins and how can they be overcome?

Working with recombinant B. phymatum proteins presents several challenges that require specific strategies:

Challenge 1: Protein Solubility and Stability Issues

  • Problem: Membrane-associated proteins like UbiB often aggregate during expression

  • Solution:

    • Utilize solubility enhancing fusion partners (MBP, SUMO, Thioredoxin)

    • Express at lower temperatures (16-20°C)

    • Include specific detergents during lysis and purification (DDM, LDAO)

    • Consider nanodiscs or liposomes for stabilization of purified protein

Challenge 2: Codon Usage Bias

  • Problem: Differences in codon preference between expression host and B. phymatum

  • Solution:

    • Synthesize codon-optimized genes for expression host

    • Use specialized E. coli strains containing rare tRNAs (Rosetta, CodonPlus)

    • Express in related Burkholderia species using recently developed recombineering systems

Challenge 3: Post-Translational Modifications

  • Problem: Critical modifications may be absent in heterologous systems

  • Solution:

    • Identify potential modification sites using bioinformatics

    • Consider expression in more closely related hosts

    • Supplement purification buffers with required cofactors (metals, flavins)

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.