Recombinant Burkholderia phymatum Protease HtpX homolog (htpX)

Shipped with Ice Packs
In Stock

Description

Biochemical Activity

HtpX homologs function as membrane-associated proteases involved in degrading misfolded membrane proteins under stress conditions . Key findings:

  • Zinc dependence: Activity requires Zn²⁺, with self-cleavage observed in the presence of zinc .

  • Substrate specificity: Degrades casein and membrane proteins like SecY in E. coli .

  • Thermosensitivity: Homologs in related species show increased expression at lower temperatures (e.g., 20–28°C), suggesting roles in cold stress adaptation .

Applications in Research

Recombinant HtpX is primarily used for:

  • Enzymatic assays: Studying protease kinetics and inhibitor screening (e.g., batimastat resistance tests) .

  • Protein interaction studies: Investigating partnerships with ATP-dependent proteases like FtsH .

  • Biotechnological tools: Engineering stress-resistant bacterial strains via HtpX overexpression .

Research Gaps and Future Directions

  • In vivo roles: The exact physiological substrates of B. phymatum HtpX remain uncharacterized.

  • Structural data: No high-resolution structures exist for this specific homolog, limiting mechanistic studies .

  • Symbiotic relevance: Links between HtpX and nitrogen fixation in legume symbiosis require further exploration .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and protein stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please specify it so we can prioritize its development.
Synonyms
htpX; Bphy_0038; Protease HtpX homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-285
Protein Length
full length protein
Species
Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815) (Burkholderia phymatum)
Target Names
htpX
Target Protein Sequence
MFNWVKTAMLMAAITALFIVIGGMIGGRSGMMFALLIALGMNFFSYWFSDKMVLRMYNAQ EVDETSAPQFYRMIRDLATRANLPMPRVYLIDEDQPNAFATGRNPEHAAVAATTGILRVL SEREMRGVMAHELSHVKHRDILISTISATMAGAISALANFAMFFGGRDENGRPANPIAGI AVALLAPIAGALIQMAISRAREFEADRGGAQISGDPQALASALDKIHRYANGIPFPTAEA HPATAQMMIMNPLAGGGIANLFSTHPSTEERIARLMEMARTGRFE
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the HtpX protease and what protein family does it belong to?

HtpX is a membrane-bound zinc metalloproteinase belonging to the M48 family of proteases. It is widely found in various bacterial species including Burkholderia, Paraburkholderia, Escherichia coli, and Priestia megaterium. In E. coli, HtpX has been characterized as a metalloproteinase located in the cytoplasmic membrane involved in quality control of membrane proteins . The protease contains characteristic metalloprotease (zincin) catalytic domains and plays important roles in protein degradation pathways within bacterial cells .

What are the key structural features of bacterial HtpX proteases?

Based on structural analysis of the DX-3-htpX protease, which can serve as a model for understanding Burkholderia phymatum HtpX homologs, the protein contains several key structural elements:

  • A peptidase M48 domain (typically spanning positions 87-289 in a 290 amino acid sequence)

  • Metalloprotease (zincin) catalytic domains critical for proteolytic activity

  • Ten α-helices, four strands, two 310 helices, twelve turns, seven bends, and multiple coil regions that form its tertiary structure

The structural integrity of these elements is essential for proper proteolytic function, as evidenced by decreased activity in mutant HtpX proteins .

How can researchers predict and analyze the tertiary structure of HtpX proteases?

Researchers can employ several computational and experimental approaches to predict and analyze HtpX tertiary structure:

What expression systems have been successfully used for recombinant HtpX production?

Based on current research, effective expression systems for recombinant HtpX production include:

  • Bacillus subtilis WB800N: This has been successfully used for expressing the htpX gene from P. megaterium DX-3. The recombinant strain WB800N/pHT43-htpX showed high expression levels when induced with IPTG .

  • Escherichia coli: E. coli expression systems have been employed in the preliminary stages of htpX cloning. For instance, the htpX gene can be initially cloned into E. coli DH5α and then into E. coli BL21 (DE3) to improve transformation efficiency before final transformation into the expression host Bacillus subtilis .

What are the methodological steps for cloning and expressing recombinant HtpX?

The following methodological approach can be used for successful cloning and expression of recombinant HtpX:

  • Primer design: Design primers containing appropriate restriction enzyme recognition sites based on the htpX sequence. For example, primers containing BamHI and SmaI restriction sites have been successfully used .

  • PCR amplification: Amplify the htpX gene using genomic DNA as a template.

  • Vector preparation and ligation: Digest the expression vector (e.g., pHT43) with appropriate restriction enzymes and ligate with the amplified htpX gene.

  • Initial transformation: Transform the recombinant plasmid into E. coli DH5α for validation through bacterial PCR and sequencing.

  • Expression host transformation: Transform the validated plasmid into the expression host (e.g., B. subtilis WB800N) via electroporation and select transformants on appropriate antibiotic-containing media.

  • Expression induction: Culture the engineered strain to mid-log phase (OD600 ≈ 0.6–0.8) and induce protein expression with IPTG (typically at 1 mM final concentration) .

  • Protein collection: Harvest the culture, centrifuge to separate cells, and collect the supernatant containing the secreted recombinant protein.

  • Verification: Confirm successful expression through SDS-PAGE electrophoresis analysis, comparing induced and non-induced samples .

What are the optimal temperature and pH conditions for HtpX activity?

Based on studies of the DX-3-htpX protease, which can inform our understanding of Burkholderia phymatum HtpX homologs:

  • Optimal temperature: The optimal reaction temperature is 45°C, where enzyme activity increases significantly (by approximately 250%) compared to activity at 30°C .

  • Optimal pH: The optimal pH for activity is 7, with the enzyme maintaining relatively high activity in the pH range of 7-9 .

How stable is HtpX under various temperature and pH conditions?

HtpX proteases demonstrate distinct stability profiles:

Recombinant DX-3-htpX protease shows improved high temperature resistance and pH tolerance compared to the native DX-3 protease, suggesting that recombinant production can enhance enzyme stability characteristics .

What methods are available for assessing HtpX protease activity?

Several methodological approaches can be used to assess HtpX protease activity:

  • In vivo assay systems: Semiquantitative and convenient protease activity assay systems have been developed for HtpX. These systems enable detection of differential protease activities of HtpX mutants carrying mutations in conserved regions .

  • Model substrates: Researchers have constructed model substrates for HtpX (such as XMS1) that allow for sensitive detection of protease activity .

  • Activity quantification: Standard enzymatic assays can measure protease activity in units (U/mL). For example, the recombinant DX-3-htpX protease exhibited a high fermentation activity of 135.68 ± 3.66 U/mL compared to the native DX-3 protease activity of 2.19 ± 0.28 U/mL .

How do different metal ions affect HtpX protease structure and function?

Metal ions significantly influence the 3D structure and active sites of HtpX proteases. Based on computational predictions using CASTpFold, the binding of Ca²⁺, Zn²⁺, Cl⁻, and K⁺ to the DX-3-htpX protease alters its 3D structure and active sites .

The table below summarizes the effects of different metal ions on the DX-3-htpX protease's active pocket dimensions:

Protease-Ion ComplexArea (Ų)Volume (ų)Effect on Active Pocket
HtpX (no ion)557.472837.241Baseline active pocket size
HtpX-Ca²⁺918.1541378.221Largest active pocket size
HtpX-K⁺925.5441335.237Second largest volume
HtpX-Zn²⁺811.0231179.127Moderate enlargement
HtpX-Cl⁻714.286867.364Smallest enlargement among tested ions

Among these ions, Ca²⁺ binding produces the largest active pocket size, potentially enhancing substrate accessibility and catalytic efficiency .

What is the specific role of zinc in HtpX proteases?

HtpX is classified as a zinc metalloproteinase in the M48 family . Zinc plays a critical role in the catalytic mechanism of these proteases:

  • Catalytic activity: Zinc is essential for the proteolytic activity of HtpX, participating directly in the catalytic mechanism.

  • Structural integrity: Zn²⁺ binding contributes to the structural stability of the enzyme.

  • Active site modification: When bound to HtpX, Zn²⁺ modifies the active pocket, increasing its area from 557.472 Ų to 811.023 Ų and its volume from 837.241 ų to 1179.127 ų, which may influence substrate recognition and binding .

How can mutagenesis studies reveal functional importance of specific HtpX residues?

Mutagenesis studies are powerful tools for investigating the structure-function relationships in HtpX proteases:

  • Activity comparison: By creating HtpX mutants with alterations in conserved regions and measuring their protease activities, researchers can identify critical functional residues. Previous studies have shown that mutant HtpX proteins typically demonstrate decreased protease activity compared to wild-type enzymes when assessed through substrate cleavage assays .

  • Substrate specificity: Mutations in specific regions can alter substrate recognition patterns, providing insights into the determinants of substrate specificity.

  • Catalytic mechanism: Targeted mutations in predicted catalytic sites can confirm their role in the enzymatic mechanism.

  • Protein-protein interactions: Mutations in surface regions may affect interactions with other proteins in membrane protein quality control pathways.

The in vivo protease activity assay system described in the literature is particularly valuable for these studies as it enables semiquantitative and convenient detection of differential protease activities among HtpX mutants .

What computational approaches are valuable for predicting HtpX substrate specificity?

Several computational approaches can be employed to predict substrate specificity of HtpX proteases:

  • 3D structure prediction: Using tools like AlphaFold3 to generate accurate structural models of HtpX provides the foundation for substrate prediction .

  • Binding pocket analysis: CASTpFold and similar tools can analyze the D3 pocket dimensions and properties, which directly influence substrate recognition .

  • Molecular docking: Simulating the interaction between HtpX and potential substrates can predict binding affinities and cleavage sites.

  • Sequence analysis: Comparing multiple aligned sequences of known HtpX substrates can reveal conserved motifs that may be recognized by the protease.

  • Machine learning approaches: Training algorithms on known protease-substrate pairs to predict novel substrates based on sequence and structural features.

These computational methods, when combined with experimental validation, can significantly advance our understanding of HtpX substrate selection and processing mechanisms.

How do HtpX homologs differ functionally across bacterial species?

While the core catalytic function of HtpX is conserved across bacterial species, several notable differences exist:

  • Enzymatic properties: The optimal conditions for activity vary between species. For example, the DX-3-htpX protease from P. megaterium shows optimal activity at 45°C and pH 7, with specific temperature and pH stability profiles . Other bacterial HtpX homologs may have distinct optimal conditions reflecting their native environments.

  • Structural variations: While the core catalytic domain is conserved, differences in peripheral domains and structural elements may influence substrate specificity and interaction partners.

  • Cellular roles: In E. coli, HtpX is primarily involved in membrane protein quality control , while in other species, the proteases may have adapted to fulfill additional or specialized functions.

  • Expression regulation: The regulation of htpX expression likely varies across bacterial species, reflecting different stress responses and physiological roles.

Comparative studies of HtpX homologs across species can provide valuable insights into the evolution of proteolytic systems and their adaptation to diverse bacterial lifestyles and environments.

What role does HtpX play in bacterial symbiotic relationships?

While direct evidence for HtpX's role in symbiotic relationships is limited in the provided materials, we can draw some connections based on bacterial systems where HtpX homologs are found:

  • Paraburkholderia phymatum symbiosis: P. phymatum establishes symbiotic relationships with legumes like Phaseolus vulgaris (common bean) . While the search results focus on the role of exopolysaccharide Cepacian in this symbiosis, membrane proteases like HtpX potentially contribute to maintaining membrane integrity and protein homeostasis during the establishment of symbiotic relationships.

  • Membrane protein regulation: As a membrane protease involved in protein quality control, HtpX may contribute to regulating membrane proteins involved in host recognition, nutrient exchange, or immune response evasion during symbiotic interactions.

  • Stress response: Symbiotic relationships often involve environmental stress adaptation, and proteases like HtpX that function in protein quality control may be important for bacterial adaptation to host environments.

Further research specifically examining HtpX function during symbiotic interactions would be valuable to clarify its precise role in these complex biological relationships.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.