Recombinant Burkholderia phytofirmans 4-hydroxybenzoate octaprenyltransferase (ubiA)

Shipped with Ice Packs
In Stock

Description

Biochemical Properties and Enzymatic Function

Recombinant Burkholderia phytofirmans ubiA catalyzes the transfer of an octaprenyl group from a prenyl diphosphate (XPP) to the meta-position of PHB, forming a prenylated intermediate in ubiquinone biosynthesis . Key characteristics include:

PropertyDetails
ReactionPHB + XPP → prenylated PHB + pyrophosphate
CofactorsRequires Mg²⁺ for catalysis
Substrate SpecificityBroadly active on XPPs with varying chain lengths (C10–C45)
KineticsLower affinity for shorter chains (e.g., geranyldiphosphate, C10); higher activity with longer chains (e.g., solanesylphosphate, C45)

The enzyme’s activity is regiospecific, ensuring prenylation occurs exclusively at the meta-position of PHB, a mechanism conserved across the UbiA superfamily .

Functional Significance in the UbiA Superfamily

The UbiA superfamily encompasses enzymes critical to microbial and eukaryotic physiology:

EnzymeFunctionBiological Role
UbiA (Bacterial)PHB prenylation → ubiquinonesElectron transport in respiratory chains; membrane stabilization
COQ2 (Human)PHB prenylation → ubiquinone-10Mitochondrial electron transport; antioxidant defense; linked to infantile diseases
MenA (Bacterial)1,4-Dihydroxy-2-naphthoic acid prenylation → menaquinonesRespiratory chain electron carrier; vitamin K biosynthesis
UBIAD1 (Human)Phylloquinone prenylation → vitamin K2Cardiovascular health; linked to Schnyder corneal dystrophy and Parkinson’s disease

While Burkholderia phytofirmans ubiA is not directly implicated in human disease, its homology to these enzymes underscores its role in microbial ubiquinone synthesis and potential adaptation to oxidative stress .

Research Applications and Experimental Uses

Recombinant Burkholderia phytofirmans ubiA is utilized in:

ApplicationDetails
Enzyme AssaysIn vitro prenylation reactions to study substrate specificity and kinetics
Structural BiologyCrystallization for elucidating substrate-binding mechanisms
ImmunoassaysELISA-based detection of ubiA in bacterial lysates
Comparative GenomicsPhylogenetic analysis of UbiA superfamily diversity across Burkholderia species

Comparative Analysis of Burkholderia UbiA Proteins

The ubiA gene is conserved across Burkholderia species, with variations in sequence and expression:

SpeciesAccessionProtein LengthExpression SystemSource
B. phytofirmansB2SXA0287 aaE. coli
B. vietnamiensisA4JBP9290 aaE. coli
B. ambifariaQ0BI45290 aaE. coli
B. pseudomalleiA3NZ16287 aaE. coli

These recombinant proteins enable comparative studies of prenyltransferase specificity and evolutionary adaptation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ubiA; Bphyt_0715; 4-hydroxybenzoate octaprenyltransferase; 4-HB polyprenyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-287
Protein Length
full length protein
Species
Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN) (Burkholderia phytofirmans)
Target Names
ubiA
Target Protein Sequence
MFARLPLYLRLVRMDKPIGSLLLLWPTLNALWIASDGHPTWPLLVIFTVGTVLMRSAGCA INDYADRDFDRYVKRTENRPITSGKIKAWEAVALAAALSLLAFLLILPLNTLTKELSVAA LFVAGSYPFTKRFFAIPQAYLGIAFGFGIPMAFAAIQGHVPLLAWVMLLANVFWSVAYDT EYAMVDRDDDIKIGIRTSALTFGRFDVAAIMICYAATLGIYVGIGVLLGFGVLYWLGWAA AAGCAIYHYTLIRNRERMACFAAFRHNNWLGGALFVGIAAHYAAGSF
Uniprot No.

Target Background

Function
This recombinant *Burkholderia phytofirmans* 4-hydroxybenzoate octaprenyltransferase (UbiA) catalyzes the prenylation of para-hydroxybenzoate (PHB) using an all-trans polyprenyl group. It mediates the second step in ubiquinone-8 (UQ-8) biosynthesis, specifically the condensation of the polyisoprenoid side chain with PHB, resulting in the formation of the initial membrane-bound Q intermediate, 3-octaprenyl-4-hydroxybenzoate.
Database Links
Protein Families
UbiA prenyltransferase family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is 4-hydroxybenzoate octaprenyltransferase (UbiA) and what is its biochemical function?

4-Hydroxybenzoate octaprenyltransferase (UbiA) is a critical enzyme in the ubiquinone biosynthesis pathway. It catalyzes the formation of 4-hydroxy-3-octaprenylbenzoate (4-H-3-OPB) from two substrates: 4-hydroxybenzoate (4-HB) and octaprenyl pyrophosphate. This prenylation reaction represents a key step in the early biosynthetic pathway of ubiquinone, which subsequently undergoes a series of decarboxylation, hydroxylation, and methylation reactions to form the final ubiquinone-8 (UQ8) molecule . The enzyme's activity is integral to the respiratory chain of many Gram-negative bacteria, making it essential for aerobic energy metabolism.

How does the ubiquinone biosynthesis pathway differ between bacteria and mammals?

The ubiquinone biosynthesis pathway shows significant differences between bacterial and mammalian systems, particularly in the early steps. In Gram-negative bacteria like Escherichia coli and Burkholderia species, 4-hydroxybenzoate (4-HB) is formed from chorismate through the action of chorismate pyruvate-lyase (UbiC). UbiA then catalyzes the prenylation of 4-HB to form 4-hydroxy-3-octaprenylbenzoate . In contrast, mammalian cells synthesize 4-HB from tyrosine rather than chorismate . This fundamental difference in precursor synthesis represents a potential target for antimicrobial development, as inhibitors targeting bacterial UbiA would potentially have limited effects on mammalian ubiquinone biosynthesis.

What structural features characterize UbiA from Burkholderia phytofirmans compared to UbiA from other bacterial species?

UbiA from Burkholderia phytofirmans shares the characteristic membrane-spanning domains found in other bacterial UbiA enzymes. While specific structural details of B. phytofirmans UbiA are not fully characterized, research on UbiA enzymes generally indicates they contain multiple transmembrane helices that form a catalytic pocket where 4-HB and prenyl diphosphate bind. The selectivity of inhibitors like 3,6-dihydroxy-1,2-benzisoxazole (DHB) depends on a particular fold of the UbiA enzyme , suggesting structural variations among UbiA enzymes from different bacterial species that could be exploited for species-specific targeting.

What are the optimal conditions for expressing recombinant Burkholderia phytofirmans UbiA in E. coli expression systems?

For successful expression of recombinant B. phytofirmans UbiA in E. coli, researchers should consider the following methodological approach:

  • Vector selection: Use expression vectors with inducible promoters (e.g., T7 or tac) that allow precise control of expression timing.

  • Host strain optimization: BL21(DE3) or C41(DE3) strains are recommended for membrane protein expression.

  • Induction conditions: Low-temperature induction (16-20°C) after cultures reach OD600 of 0.6-0.8, with reduced IPTG concentration (0.1-0.5 mM) to prevent inclusion body formation.

  • Growth media supplementation: Addition of glucose should be avoided as it is a known repressor of ubiA transcription , which could interfere with expression studies.

  • Membrane fraction preparation: Gentle cell lysis using enzymatic methods rather than sonication helps preserve enzyme activity.

This methodological approach addresses the challenges of expressing membrane-bound prenyltransferases while maintaining their functional integrity.

What purification strategies yield the highest activity retention for recombinant UbiA?

Purification of recombinant UbiA requires specialized techniques to maintain the enzyme in its native conformation:

  • Detergent selection: Mild detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin at concentrations just above their critical micelle concentration effectively solubilize UbiA while preserving activity.

  • Affinity purification: Histidine-tagged constructs purified via Ni-NTA chromatography under optimized detergent conditions yield good results.

  • Buffer composition: Incorporation of glycerol (10-15%) and reducing agents (2-5 mM DTT or β-mercaptoethanol) helps stabilize the enzyme.

  • Temperature control: All purification steps should be performed at 4°C to minimize protein denaturation.

  • Activity preservation: Addition of exogenous lipids (E. coli total lipid extract at 0.1-0.2 mg/mL) during purification helps maintain the enzyme in a native-like membrane environment.

These methodological considerations address the technical challenges associated with membrane protein purification while maximizing retention of catalytic activity.

What are the most reliable methods for measuring UbiA enzymatic activity in vitro?

Several complementary approaches can be employed to accurately measure UbiA activity:

  • Radioisotope-based assays: Using 14C-labeled 4-HB as substrate and measuring the formation of radiolabeled 4-hydroxy-3-octaprenylbenzoate via thin-layer chromatography or HPLC.

  • HPLC-based assays: Detection of the prenylated product by reversed-phase HPLC with UV detection at 254 nm.

  • Coupled enzyme assays: Monitoring the release of pyrophosphate using commercially available pyrophosphate detection kits.

  • LC-MS/MS detection: Providing both quantitative measurement and structural confirmation of the prenylated products.

The recommended reaction buffer contains 50 mM Tris-HCl (pH 7.5), 5 mM MgCl2, 0.1% detergent (DDM), and 1 mM DTT. Reaction temperature should be maintained at 30°C, with time-course measurements to ensure linearity of product formation.

How can researchers accurately determine kinetic parameters for recombinant UbiA when using synthetic substrates?

Accurate kinetic analysis of UbiA requires careful consideration of several methodological aspects:

ParameterRecommended MethodologyAnalytical Considerations
Km for 4-HBVarying 4-HB concentration (1-100 μM) while maintaining saturating prenyl donor (≥100 μM)Account for potential substrate inhibition at high 4-HB concentrations
Km for prenyl donorVarying prenyl donor concentration (1-100 μM) with saturating 4-HB (≥50 μM)Use freshly prepared prenyl pyrophosphate solutions to prevent degradation
Vmax determinationInitial velocity measurements at <10% substrate consumptionEnsure linear relationship between enzyme concentration and reaction rate
Detergent effectsTest multiple detergent concentrationsDevelop correction factors for micelle partitioning of hydrophobic substrates
Data analysisNon-linear regression using Michaelis-Menten or appropriate equationsConsider potential cooperativity and apply Hill equation if necessary

When analyzing kinetic data, researchers should be aware that the hydrophobic nature of the prenyl donor and the membrane-associated nature of UbiA can complicate traditional enzyme kinetic analyses. Micelle partitioning effects can lead to apparent Km values that differ from true thermodynamic constants.

What analytical techniques are most appropriate for detecting the prenylated products of UbiA catalysis?

The detection and characterization of UbiA reaction products require sophisticated analytical approaches:

  • HPLC-UV analysis: Utilizing C18 reverse-phase columns with gradient elution (water/acetonitrile with 0.1% formic acid), monitoring at 254 nm.

  • LC-MS identification: Employing electrospray ionization in negative mode ([M-H]- for 4-hydroxy-3-octaprenylbenzoate).

  • NMR characterization: For structural confirmation of prenylated products, particularly to verify the position of prenylation.

  • Extraction protocols: Acidification of the reaction mixture to pH 2, followed by extraction with ethyl acetate provides optimal recovery of prenylated products.

These analytical approaches enable not only quantification but also structural verification of UbiA catalytic products, which is particularly important when investigating substrate analogs or enzyme variants.

How does 3,6-dihydroxy-1,2-benzisoxazole (DHB) inhibit UbiA, and what methods can be used to characterize this interaction?

DHB exhibits a unique dual mechanism of action against UbiA:

  • Competitive inhibition: DHB competes with 4-hydroxybenzoate (4-HB) for binding to the UbiA active site, acting as a substrate mimic .

  • Prodrug mechanism: Remarkably, DHB itself becomes prenylated by UbiA, forming a chimeric product that contributes to the antimicrobial effect .

To study this interaction, researchers can employ:

  • Enzyme inhibition assays: IC50 determination using varying concentrations of DHB (0.1-100 μM).

  • Antagonism studies: Checkerboard assays with DHB and 4-HB demonstrate competition with an FIC value of 8 .

  • Product analysis: LC-MS/MS to detect the prenylated DHB product.

  • Binding studies: Isothermal titration calorimetry or surface plasmon resonance to directly measure binding affinities.

The prenylation of DHB by UbiA represents an unusual case where an inhibitor also serves as a substrate, creating toxic products that enhance antimicrobial activity.

What experimental approaches can elucidate the binding site interactions between UbiA and its substrates or inhibitors?

Several complementary approaches can provide insights into UbiA-substrate interactions:

  • Site-directed mutagenesis: Systematic mutation of conserved residues, particularly those predicted to interact with 4-HB or prenyl donors, followed by kinetic analysis.

  • Photoaffinity labeling: Using photoactivatable analogs of 4-HB or prenyl donors to covalently tag the binding site.

  • Hydrogen-deuterium exchange mass spectrometry: To identify regions of the protein that undergo conformational changes upon substrate or inhibitor binding.

  • Computational modeling: Molecular docking and molecular dynamics simulations to predict binding modes and interaction energies.

  • Resistance mutation analysis: Studying UbiA variants that confer resistance to inhibitors like DHB can identify critical residues in the binding site .

This multi-faceted approach provides a comprehensive understanding of the molecular interactions that govern substrate specificity and inhibitor sensitivity in UbiA enzymes.

Which conserved amino acid residues are critical for UbiA catalytic activity, and how can they be systematically investigated?

Key residues in UbiA can be investigated through a structured approach:

  • Sequence alignment analysis: Identification of conserved residues across UbiA enzymes from different bacterial species.

  • Structural homology modeling: Using related membrane prenyltransferase structures to predict the spatial arrangement of catalytic residues.

  • Alanine-scanning mutagenesis: Systematic replacement of conserved residues with alanine to assess their contribution to catalysis.

  • Activity assays of mutants: Quantification of both Km and kcat changes to distinguish between binding and catalytic effects.

  • Rescue experiments: Testing whether chemical rescue (e.g., with imidazole for histidine mutants) can restore activity.

Particularly important are residues involved in magnesium coordination, as divalent metal ions are essential for catalyzing the prenyl transfer reaction. Conserved aspartate residues often play this role in prenyltransferases.

How can researchers engineer UbiA variants with altered substrate specificity or enhanced catalytic efficiency?

Protein engineering of UbiA can be approached through these methodologies:

  • Rational design: Based on structural understanding and sequence comparisons with UbiA enzymes that have different substrate preferences.

  • Semi-rational approaches: Creating small libraries focused on residues lining the substrate binding pocket.

  • Directed evolution: Using error-prone PCR or DNA shuffling followed by high-throughput screening for desired properties.

  • Screening strategies: Development of colorimetric or fluorescence-based assays that can detect prenylated products in bacterial colonies.

  • Validation: Detailed kinetic characterization of engineered variants with different substrate analogs.

When designing UbiA variants with altered specificity, researchers should focus on residues that interact with the aromatic moiety of 4-HB, as these are likely to determine selectivity between different benzoate derivatives.

How does UbiA expression and activity respond to different growth conditions and stress factors?

UbiA regulation appears to be complex and responsive to several environmental factors:

  • Carbon source effects: Glucose represses ubiA transcription , suggesting catabolite repression mechanisms.

  • Oxygen availability: As ubiquinone functions primarily in aerobic respiration, oxygen levels likely influence UbiA expression.

  • Growth phase dependency: Expression patterns may differ between exponential and stationary phases.

  • Stress responses: Oxidative stress may upregulate the ubiquinone biosynthesis pathway to increase antioxidant capacity.

To study these effects, researchers can employ:

  • RT-qPCR to measure ubiA transcript levels under different conditions

  • Western blotting with specific antibodies to quantify protein levels

  • Activity assays in membrane fractions from cells grown under various conditions

  • Reporter gene fusions to monitor promoter activity in real-time

What are the implications of UbiA inhibition for bacterial physiology and potential antimicrobial development?

Inhibition of UbiA has multifaceted effects on bacterial physiology:

  • Energy metabolism disruption: Reduced ubiquinone synthesis impairs electron transport chain function, decreasing ATP production.

  • Oxidative stress: Ubiquinone serves as an antioxidant; its depletion increases vulnerability to reactive oxygen species.

  • Membrane integrity: Changes in membrane composition due to altered quinone content may affect bacterial membrane properties.

  • Selective toxicity: DHB is active against a range of Gram-negative bacteria including Escherichia coli, Enterobacter cloacae, Klebsiella pneumoniae, and Acinetobacter baumannii , while showing inactivity against anaerobic gut bacteria and non-toxicity to human cells .

These findings highlight UbiA as a promising target for antimicrobial development, particularly against aerobic Gram-negative pathogens.

How does UbiA differ from other prenyltransferases, particularly MenA, in structure and function?

UbiA and MenA (involved in menaquinone biosynthesis) share several features but also exhibit important differences:

  • Structural similarities: Both enzymes are integral membrane proteins with multiple transmembrane domains and similar catalytic mechanisms involving prenyl transfer.

  • Substrate specificity: While UbiA utilizes 4-hydroxybenzoate, MenA uses 1,4-dihydroxy-2-naphthoate (DHNA) as the acceptor substrate .

  • Reaction chemistry: Both catalyze prenylation reactions, but at different positions and on different aromatic scaffolds.

  • Inhibitor profiles: Compounds targeting UbiA may not necessarily inhibit MenA with equal potency, despite their mechanistic similarities.

Comparative studies between these enzymes can provide insights into the evolution of prenyltransferases and inform the design of selective inhibitors.

What techniques can be used to study the evolutionary relationships between UbiA enzymes from different bacterial species?

Evolutionary analysis of UbiA enzymes can be approached through:

  • Phylogenetic analysis: Construction of phylogenetic trees based on UbiA sequences from diverse bacterial species.

  • Ancestral sequence reconstruction: Computational prediction and experimental validation of ancestral UbiA forms.

  • Horizontal gene transfer analysis: Examination of genomic context and GC content to identify potential horizontal transfer events.

  • Structure-based phylogeny: Comparison of predicted structural features rather than primary sequences.

  • Functional convergence studies: Identification of independently evolved solutions to similar biochemical challenges.

Such analyses can reveal how selective pressures have shaped UbiA evolution in different bacterial lineages and potentially identify species-specific features that could be exploited for targeted antimicrobial development.

How can researchers develop high-throughput screening systems for identifying novel UbiA inhibitors?

Development of efficient screening systems requires:

  • Enzyme-based primary screens:

    • In vitro assays using purified recombinant UbiA

    • Fluorescence-based detection of pyrophosphate release

    • Adaptation to 384 or 1536-well formats for increased throughput

  • Cell-based secondary screens:

    • Growth inhibition assays in wild-type vs. ubiA-overexpressing strains

    • Metabolic labeling to quantify ubiquinone synthesis

    • Comparison with effects in ΔaaeB strains, which show increased resistance to UbiA inhibitors due to 4-HB accumulation

  • Counter-screens for selectivity:

    • Testing against mammalian cells to ensure absence of cytotoxicity

    • Evaluation against anaerobic bacteria to confirm target specificity

  • Structure-activity relationship analysis:

    • Systematic modification of hit compounds

    • Correlation between inhibitory potency and physicochemical properties

This comprehensive screening cascade enables efficient identification and optimization of UbiA inhibitors with potential antimicrobial applications.

What methodological approaches can resolve contradictory data on UbiA inhibitor potency in different experimental systems?

Researchers investigating discrepancies in UbiA inhibitor potency should consider these methodological factors:

  • Media composition effects: The reported potency of DHB against E. coli varies dramatically (from <1 μg/mL to >500 μg/mL) depending on growth media . Standardized testing conditions are essential for meaningful comparisons.

  • Glucose supplementation: Addition of glucose to growth media represses ubiA transcription , potentially affecting inhibitor efficacy. Testing in defined media with controlled carbon sources is recommended.

  • 4-HB concentration: Variable amounts of 4-HB in different media can affect antagonism with inhibitors like DHB . Synthetic media with defined 4-HB concentrations should be used for consistent results.

  • Efflux pump activity: Expression levels of efflux pumps like AaeAB, which control intracellular 4-HB levels, significantly impact sensitivity to UbiA inhibitors . Isogenic strains with defined efflux pump expression should be used for comparative studies.

  • Methodological standardization:

    • Consistent inoculum preparation (growth phase, density)

    • Standardized MIC determination protocols

    • Controlled incubation conditions

    • Transparent reporting of all experimental variables

Implementing these methodological controls can help resolve contradictory data and provide more reliable assessments of UbiA inhibitor efficacy.

How might cryo-electron microscopy advance our understanding of UbiA structure and mechanism?

Cryo-electron microscopy (cryo-EM) offers several advantages for studying membrane proteins like UbiA:

  • Structural determination without crystallization: Overcoming the challenges of obtaining diffraction-quality crystals of membrane proteins.

  • Native-like lipid environment: Visualization of UbiA in nanodiscs or other membrane mimetics that better represent its physiological context.

  • Conformational dynamics: Potential to capture different functional states of the enzyme during the catalytic cycle.

  • Substrate and inhibitor complexes: Direct visualization of binding modes for substrates and inhibitors like DHB.

  • High-resolution insights: Recent advances in cryo-EM now permit near-atomic resolution of membrane proteins.

Cryo-EM could reveal critical details about the prenyl transfer mechanism, including the orientation of substrates and the conformational changes that occur during catalysis.

What are the challenges and opportunities in developing UbiA-targeted antimicrobials with reduced resistance potential?

The development of UbiA-targeted antimicrobials presents unique challenges and opportunities:

  • Resistance mechanisms: Understanding potential resistance pathways, such as mutations in UbiA that maintain function while preventing inhibitor binding, or upregulation of efflux pumps like AaeAB that affect intracellular inhibitor concentrations .

  • Dual-action strategy: Leveraging the unusual dual mechanism of DHB (both competitive inhibition and forming toxic prenylated products) might reduce resistance development, as multiple simultaneous mutations would be required.

  • Combination approaches: Co-targeting multiple steps in the ubiquinone biosynthesis pathway could increase efficacy and reduce resistance potential.

  • Species selectivity: Developing inhibitors that exploit structural differences between UbiA enzymes from different bacterial species could enable more targeted antimicrobial approaches.

  • Alternative respiratory pathways: Understanding how bacteria might compensate for UbiA inhibition through upregulation of alternative respiratory quinones like menaquinone.

These considerations highlight both the challenges in developing resistance-proof UbiA inhibitors and the opportunities for innovative antimicrobial strategies based on this essential enzyme.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.