Recombinant Burkholderia phytofirmans Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Enzymatic Mechanism and Substrate Specificity

PlsY catalyzes the first committed step in phospholipid biosynthesis:
G3P + acyl-phosphateLPA + phosphate\text{G3P + acyl-phosphate} \rightarrow \text{LPA + phosphate}
This reaction is ATP-independent, distinguishing PlsY from other acyltransferases that use acyl-CoA substrates . Key findings:

  • Substrate preference: Utilizes C16:0 and C18:1 acyl-phosphates in Burkholderia species, favoring saturated fatty acids for membrane lipid synthesis .

  • pH and temperature optima: Activity peaks at pH 8.0–8.5 and 37°C, aligning with E. coli expression conditions .

  • Inhibitors: Sensitive to thiol-reactive agents (e.g., N-ethylmaleimide), suggesting a catalytic role for cysteine residues .

Industrial Lipid Engineering

Recombinant PlsY enables microbial production of tailored phospholipids and polyhydroxyalkanoates (PHAs). For example:

  • PHA biosynthesis: In Burkholderia sensu lato, PlsY supplies precursors for medium-chain-length PHAs, biodegradable polymers used in medical and packaging industries .

  • Metabolic flexibility: Co-expression with thioesterases redirects fatty acid flux toward PHAs, achieving titers up to 60% cell dry weight in engineered strains .

Agricultural Research

PlsY-derived lipids influence plant-microbe interactions:

  • Stress tolerance: B. phytofirmans PsJN enhances host plant resilience by modulating lipid signaling pathways, though direct evidence linking this to PlsY remains under investigation .

  • Biofuel production: PsJN-inoculated plants show increased lignocellulosic sugar release (e.g., glucose by 22%), potentially linked to lipid-mediated cell wall modifications .

Challenges and Future Directions

  • Structural insights: No crystal structure exists for PlsY; homology modeling is limited by low sequence similarity to characterized acyltransferases .

  • Industrial scaling: Low solubility of recombinant PlsY in non-tagged forms necessitates optimization of expression systems .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have a specific format requirement, please specify it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which you can use as a reference.
Shelf Life
The shelf life depends on various factors such as storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
plsY; Bphyt_3209; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-214
Protein Length
full length protein
Species
Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN) (Burkholderia phytofirmans)
Target Names
plsY
Target Protein Sequence
MQNLIVAVVAYLIGSVSFAVIVSAAMGLDDPRSYGSGNPGATNVLRSGNKKAAILTLIGD AFKGWLPVWFVVHYGARYGLDETSVAIASVAVFLGHLYPVFFRFKGGKGVATAAGVLLAI NPILGVATLLTWLIVAFFTRYSSLAALAAAVFAPIFDGFLFGPHVIALAIVVMSSLLVWR HRGNIAKLMRGQESRIGDKKKADAAAKPAGGSDV
Uniprot No.

Target Background

Function
Catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P) to form lysophosphatidic acid (LPA). This enzyme utilizes acyl-phosphate as a fatty acyl donor, but not acyl-CoA or acyl-ACP.
Database Links
Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic function of Glycerol-3-phosphate acyltransferase (plsY) in Burkholderia phytofirmans?

Glycerol-3-phosphate acyltransferase (plsY) in B. phytofirmans functions as a critical enzyme in phospholipid biosynthesis by catalyzing the transfer of acyl groups from acylphosphate to glycerol-3-phosphate. This reaction represents the first committed step in membrane phospholipid synthesis in many bacteria . The enzyme works in concert with PlsX, which converts acyl-acyl carrier protein to acylphosphate, with plsY subsequently transferring the acyl group to glycerol-3-phosphate . This pathway is essential for bacterial membrane formation and integrity, making plsY vital for bacterial survival and adaptation to different environmental conditions.

The protein is classified as an integral membrane protein with multiple membrane-spanning segments that anchor it within the bacterial cell membrane . The specific Uniprot accession number for B. phytofirmans plsY is B2SY66, and its genomic locus is designated as Bphyt_3209 . Within B. phytofirmans, this enzyme contributes to the bacterium's ability to maintain membrane homeostasis during colonization of plant tissues and adaptation to various environmental stresses.

How does plsY fit into the broader context of Burkholderia phytofirmans biology?

Burkholderia phytofirmans PsJN is a well-characterized plant-associated endophytic bacterium with remarkable capabilities to colonize diverse plant species and promote plant growth . It possesses a large genome consisting of two chromosomes and one plasmid, equipping it with extensive metabolic versatility . Within this genomic context, plsY serves as a critical component of the bacterium's membrane phospholipid biosynthesis machinery.

The bacterium's lifestyle as an endophyte requires adaptation to various plant environments, defense against plant immune responses, and maintenance of proper membrane function under different conditions . B. phytofirmans PsJN is known to confer resistance to plants against both biotic and abiotic stresses and can form biofilms both in vitro and in planta . The plsY enzyme contributes to membrane lipid composition, which may play roles in:

  • Adaptation to different plant hosts

  • Response to environmental stresses

  • Biofilm formation capabilities

  • Membrane modifications during transitions between free-living and endophytic lifestyles

As B. phytofirmans exhibits phenotypic variations under certain conditions, including enhanced biofilm formation capabilities , the regulation and activity of membrane-related enzymes like plsY may be critical factors in these adaptive responses.

What are the catalytic mechanisms and critical residues in B. phytofirmans plsY?

The catalytic activity of B. phytofirmans plsY depends on three highly conserved sequence motifs found within its cytoplasmic domains. Based on studies of bacterial plsY proteins, site-directed mutagenesis has revealed specific residues critical for catalytic function :

Motif 1: Contains essential serine and arginine residues crucial for catalysis. The serine likely participates in the nucleophilic attack during the acyl transfer reaction, while the positively charged arginine may stabilize negatively charged transition states or interact with the phosphate group of the substrate .

Motif 2: Exhibits characteristics of a phosphate-binding loop and corresponds to the glycerol-3-phosphate binding site. Mutations of conserved glycines to alanines in this motif result in a Km defect for glycerol-3-phosphate binding, indicating their importance in substrate recognition and binding .

Motif 3: Contains a conserved histidine and asparagine that are important for activity, along with a glutamate that is critical to the structural integrity of the protein .

Table 1: Critical residues in plsY motifs and their proposed functions

MotifCritical ResiduesProposed Function
Motif 1Serine, ArginineNucleophilic attack, charge stabilization
Motif 2Conserved GlycinesGlycerol-3-phosphate binding
Motif 3Histidine, Asparagine, GlutamateCatalytic activity, structural integrity

The catalytic mechanism likely involves proper positioning of both the acylphosphate and glycerol-3-phosphate substrates, followed by nucleophilic attack and formation of an acyl-enzyme intermediate before product release .

How does the membrane topology of plsY influence its function in B. phytofirmans?

The membrane topology of plsY is crucial to its function, as it must properly position its catalytic domains to access substrates while maintaining appropriate membrane integration. Studies using the substituted cysteine accessibility method have shown that bacterial plsY proteins typically have five membrane-spanning segments with the amino terminus and two short loops located on the external face of the membrane .

This topology creates three larger cytoplasmic domains that contain the conserved catalytic motifs essential for enzyme function . The positioning of these domains is critical because:

  • The cytoplasmic orientation allows access to the acylphosphate and glycerol-3-phosphate substrates generated in the cytoplasm

  • The membrane integration positions the enzyme near the site where newly synthesized phospholipids will be incorporated

  • The multiple membrane spans may help stabilize the enzyme within the lipid bilayer

The membrane topology of B. phytofirmans plsY likely follows this general pattern, with slight species-specific variations that may reflect adaptations to its unique endophytic lifestyle. The hydrophobic nature of many residues in the B. phytofirmans plsY sequence (e.g., MQNLIVAVVAYLIGSVSFAVIVSAAMGL...) is consistent with membrane-spanning regions .

Understanding this topology is essential for structure-function studies and for designing experiments that target specific domains without disrupting membrane integration.

What role might plsY play in the adaptation of Burkholderia phytofirmans to different plant hosts?

Burkholderia phytofirmans PsJN is remarkable for its ability to colonize a wide range of plant hosts and adapt to various plant environments . As a key enzyme in membrane phospholipid biosynthesis, plsY likely contributes significantly to these adaptive capabilities through several mechanisms:

  • Membrane composition modulation: The activity of plsY could be regulated to alter membrane phospholipid composition in response to different plant host environments, affecting membrane fluidity, permeability, and protein function.

  • Stress response participation: During colonization, B. phytofirmans encounters various plant defense responses. Modification of membrane properties through altered plsY activity may contribute to stress tolerance.

  • Biofilm formation support: B. phytofirmans can form robust biofilms both in vitro and in planta, particularly on Arabidopsis roots . The phospholipids generated through plsY activity likely contribute to the membrane properties required for biofilm formation.

  • Phenotypic variation involvement: B. phytofirmans can develop mucoid variants with enhanced biofilm formation capabilities and modified patterns of microbe-associated molecular patterns (MAMPs) . Alterations in membrane composition through plsY activity could contribute to these phenotypic variations.

Research examining the expression and activity of plsY across different plant colonization scenarios could reveal whether this enzyme is differentially regulated during adaptation to various plant hosts or environmental conditions.

What are the optimal conditions for expressing and purifying recombinant B. phytofirmans plsY?

Expression and purification of recombinant B. phytofirmans plsY presents several challenges due to its nature as an integral membrane protein. Based on general approaches for similar proteins, the following methodological considerations are important:

Expression Systems:

  • Bacterial expression systems (particularly E. coli) with specialized strains designed for membrane protein expression (e.g., C41(DE3), C43(DE3), or Lemo21(DE3))

  • Expression vectors containing strong but controllable promoters (e.g., T7 with lac operator)

  • Fusion tags that enhance solubility and facilitate purification (e.g., His-tag, MBP, or SUMO)

Expression Conditions:

  • Reduced temperature (16-25°C) to slow protein synthesis and facilitate proper folding

  • Lower inducer concentrations to prevent formation of inclusion bodies

  • Addition of glycerol or specific lipids to culture media to support membrane protein folding

Solubilization and Purification:

  • Careful selection of detergents for membrane protein solubilization (e.g., DDM, LDAO, or digitonin)

  • Addition of lipids during purification to maintain protein stability

  • Purification using affinity chromatography based on fusion tags

  • Size exclusion chromatography to obtain homogeneous protein preparations

Storage Conditions:

  • Storage in appropriate buffer containing 50% glycerol at -20°C or -80°C

  • Avoidance of repeated freeze-thaw cycles

  • For short-term storage, maintain aliquots at 4°C for up to one week

Table 2: Recommended storage conditions for recombinant B. phytofirmans plsY

Storage DurationTemperatureBuffer Components
Short-term (≤1 week)4°CTris-based buffer
Medium-term-20°CTris-based buffer with 50% glycerol
Long-term-80°CTris-based buffer with 50% glycerol

These conditions can be optimized based on specific experimental requirements and the intended downstream applications of the purified protein.

What assays can be used to measure plsY activity in vitro?

Several assay methods can be employed to measure the enzymatic activity of plsY from B. phytofirmans in vitro:

Radiometric Assays:

  • Using radiolabeled substrates (e.g., [14C]glycerol-3-phosphate or 32P-labeled acylphosphate)

  • Measuring the incorporation of radioactivity into lysophosphatidic acid (LPA)

  • Quantification by thin-layer chromatography (TLC) followed by autoradiography or scintillation counting

Coupled Enzyme Assays:

  • Linking plsY activity to secondary reactions that can be monitored spectrophotometrically

  • For example, coupling the release of inorganic phosphate to a phosphate detection system

Mass Spectrometry-Based Assays:

  • Directly measuring the formation of lysophosphatidic acid products

  • Using LC-MS/MS for quantitative analysis of reaction products

  • Allowing for detailed characterization of acyl chain specificity

Fluorescence-Based Assays:

  • Utilizing fluorescently labeled substrates or detecting products through fluorescent dyes

  • Providing real-time monitoring capabilities

  • Potentially adaptable to high-throughput screening formats

When designing plsY activity assays, several considerations are important:

  • The need for proper solubilization and reconstitution of the membrane protein

  • Selection of appropriate detergent concentrations that maintain activity without inhibition

  • Optimization of buffer conditions, pH, and ionic strength

  • Consideration of potential inhibitors, such as palmitoyl-CoA

  • Controls to distinguish plsY activity from other acyltransferases

A comprehensive characterization would typically involve multiple complementary assay approaches to validate the enzymatic properties of recombinant plsY.

How can researchers investigate the impact of B. phytofirmans plsY mutations on plant colonization?

Investigating the impact of plsY mutations on plant colonization by B. phytofirmans requires a multifaceted approach that combines molecular genetics, microscopy, and plant biology techniques:

Generation of plsY Mutants:

  • Site-directed mutagenesis targeting conserved catalytic residues

  • Construction of deletion mutants or conditional knockdowns

  • CRISPR-Cas9 genome editing for precise mutations

  • Complementation studies with wild-type plsY to confirm phenotypes

In vitro Characterization:

  • Biochemical assays to measure altered enzyme activity

  • Lipidomic analyses to detect changes in membrane phospholipid composition

  • Growth curve analyses under different conditions

  • Biofilm formation assays to assess attachment capabilities

Plant Colonization Studies:

  • Inoculation of model plants (e.g., Arabidopsis thaliana) with wild-type and mutant strains

  • Quantification of bacterial populations in rhizosphere and endosphere over time

  • Confocal microscopy with fluorescently labeled bacteria to visualize colonization patterns

  • Assessment of plant growth parameters to determine effects on plant-growth promotion

Stress Response Evaluation:

  • Testing colonization under various stress conditions (temperature, pH, salinity)

  • Examining mutant survival during plant defense responses

  • Assessing competitive fitness against wild-type strains in co-inoculation experiments

Transcriptomic and Proteomic Analyses:

  • RNA-seq or microarray studies to identify compensatory pathways

  • Proteomic analyses to detect changes in membrane protein composition

  • Metabolomic studies to identify altered metabolic profiles

This approach would be particularly valuable for understanding how membrane phospholipid composition influences the endophytic lifestyle of B. phytofirmans and its remarkable ability to colonize diverse plant species .

How might plsY inhibitors be developed as potential antimicrobial agents against Burkholderia species?

The development of plsY inhibitors as antimicrobial agents against Burkholderia species represents a promising research direction, given the essential role of this enzyme in bacterial membrane phospholipid biosynthesis. Several approaches could be pursued:

Structure-Based Drug Design:

  • Determination of the three-dimensional structure of B. phytofirmans plsY through X-ray crystallography or cryo-EM

  • In silico screening of compound libraries targeting the active site or allosteric sites

  • Rational design of inhibitors based on substrate analogs or transition state mimics

High-Throughput Screening:

  • Development of robust activity assays adaptable to high-throughput formats

  • Screening of natural product libraries, synthetic compound collections, or fragment libraries

  • Prioritization of compounds that show specificity for bacterial plsY over mammalian acyltransferases

Mechanism-Based Inhibitor Design:

  • Exploitation of the known non-competitive inhibition by palmitoyl-CoA

  • Development of acylphosphate analogs that bind irreversibly to active site residues

  • Design of compounds targeting the conserved motifs identified as critical for catalysis

Considerations for Burkholderia-Specific Targeting:

  • Analysis of unique features in Burkholderia plsY compared to other bacterial species

  • Exploitation of any differences in the binding pocket or regulatory mechanisms

  • Development of delivery systems that can access intracellular bacteria, particularly for endophytic species

What is the potential role of plsY in B. phytofirmans biofilm formation and host immune evasion?

The potential roles of plsY in biofilm formation and host immune evasion by B. phytofirmans merit further investigation, particularly given the observed phenotypic variations and biofilm-forming capabilities of this bacterium .

Biofilm Formation:
B. phytofirmans can form robust biofilms both in vitro and in planta, particularly on Arabidopsis roots . The role of plsY in this process might include:

  • Contribution to membrane phospholipid composition changes required during the transition from planktonic to sessile lifestyles

  • Involvement in the production of membrane-derived vesicles that contribute to the biofilm matrix

  • Support for the expression or proper functioning of membrane proteins involved in adhesion

  • Participation in signaling pathways that regulate biofilm development

Research approaches could include:

  • Creation of plsY conditional mutants to examine biofilm formation capabilities

  • Lipidomic analysis of biofilm-associated cells versus planktonic cells

  • Examination of plsY expression levels during biofilm formation

  • Structural characterization of membranes in biofilm vs. planktonic cells

Host Immune Evasion:
B. phytofirmans variants display alterations in microbe-associated molecular patterns (MAMPs) and induce lower expression of plant defense genes PR1 and PDF1.2 compared to the parental strain . The potential role of plsY in these processes could include:

  • Modification of membrane lipid composition to alter recognition by plant pattern recognition receptors

  • Changes in the presentation or structure of membrane-associated MAMPs

  • Support for membrane remodeling during adaptation to plant defense responses

  • Contribution to the production of modified lipid molecules that may interfere with plant signaling

These investigations would provide valuable insights into the molecular mechanisms underlying the successful endophytic lifestyle of B. phytofirmans and its ability to promote plant growth across diverse host species.

How does the function of plsY in B. phytofirmans compare with homologs in other plant-associated bacteria?

Comparative analysis of plsY function across different plant-associated bacteria can provide valuable insights into evolutionary adaptations and specialized roles in plant-microbe interactions:

Structural and Functional Comparisons:

  • Sequence alignment of plsY proteins from various plant-associated bacteria (endophytes, rhizosphere colonizers, and pathogens)

  • Identification of conserved and divergent regions that might reflect niche-specific adaptations

  • Comparison of substrate specificities and catalytic efficiencies

  • Examination of regulatory mechanisms controlling plsY expression across species

Genomic Context Analysis:

  • Investigation of the organization of plsY and related genes in different bacterial genomes

  • Identification of co-evolved gene clusters that might indicate functional relationships

  • Analysis of horizontal gene transfer events that might have contributed to acquisition of specialized plsY variants

B. phytofirmans PsJN is particularly interesting for comparative studies because of its large genome and broad host range . In contrast to some other endophytes with more restricted host ranges, B. phytofirmans has an exceptionally versatile lifestyle, which might be reflected in specialized features of its membrane biosynthesis enzymes like plsY.

Table 3: Comparison of features between B. phytofirmans and other plant-associated bacteria

Bacterial SpeciesLifestyleGenome SizeHost RangeNotable Features
B. phytofirmans PsJNEndophyteLarge (2 chromosomes, 1 plasmid)BroadGrowth promotion, stress protection
Other endophytesEndophyteVariableOften restrictedSpecialized adaptations to specific hosts
Rhizosphere bacteriaRhizosphere colonizerVariableVariableSoil adaptation mechanisms
Plant pathogensPathogenVariableVariableVirulence factors

Research approaches could include:

  • Heterologous expression of plsY variants from different species

  • In vivo complementation studies in various bacterial backgrounds

  • Structural biology approaches to identify species-specific features

  • Comparative genomics and phylogenetic analyses

Such comparative studies would contribute to our understanding of how membrane phospholipid biosynthesis has evolved to support different plant-microbe interaction strategies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.