Recombinant Burkholderia phytofirmans Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Description

Functional Role in Bacteria

MscL serves as a last-resort osmoprotective mechanism, preventing cell lysis during rapid osmotic changes. Its activity is tightly regulated by membrane tension and lipid-protein interactions. In Burkholderia phytofirmans, MscL may contribute to:

  • Osmoregulation: Rapid solute efflux during hypo-osmotic shock.

  • Membrane integrity: Maintenance of cellular turgor pressure in fluctuating environments.

While Burkholderia phytofirmans is well-documented for plant growth promotion and biofilm formation , its MscL has not been explicitly studied in these contexts.

Modulation and Agonists

  • Dihydrostreptomycin (DHS): Binds to MscL, inducing partial opening and facilitating antibiotic uptake .

  • SCH-79797: A small-molecule activator that binds at the S1-TM2 interface, causing membrane permeabilization .

Drug Targeting

MscL’s large pore and mechanosensitivity make it a candidate for drug delivery systems. For example:

  • Nanovalves: Engineered MscL could release therapeutic agents in response to mechanical triggers .

  • Antibiotic resistance: MscL-mediated uptake of antibiotics like DHS highlights its role in bacterial susceptibility .

Plant-Microbe Interactions

While Burkholderia phytofirmans PsJN is known to enhance plant stress tolerance , MscL’s direct involvement in these processes remains unexplored.

Table 1: Key Properties of MscL Across Organisms

PropertyE. coli MscL TbMscL Burkholderia phytofirmans (Hypothetical)
Conductance~3 nS~3 nS~3 nS (inferred)
Pore Diameter~3 nm~3 nm~3 nm
Activation Pressure0.1–0.3 atm0.1–0.3 atmNot reported
Key MutantsL19V, V23IL89WNot studied

Table 2: Recombinant MscL Products and Uses

SourceProduct DescriptionApplicationsSource
CUSABIO TECHNOLOGY LLCRecombinant Burkholderia phytofirmans MscLStructural studies, drug screening
E. coli systemsPurified MscL in liposomesElectrophysiology, channel gating studies

Research Gaps and Future Directions

  • Burkholderia-specific studies: No direct evidence links MscL to the plant-growth-promoting or biofilm-forming phenotypes of Burkholderia phytofirmans PsJN.

  • Functional characterization: Electrophysiological data for Burkholderia phytofirmans MscL are lacking.

  • Biotechnological optimization: Engineering MscL for controlled drug release or stress response modulation.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mscL; Bphyt_1871; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-148
Protein Length
full length protein
Species
Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN) (Burkholderia phytofirmans)
Target Names
mscL
Target Protein Sequence
MSMVKEFKEFALKGNVMDLAVGVIIGGAFSTIVNSIVKDLIMPVVGLATGGLDFSNKFVR LGPIPPTFKGSPESYKDLQTAGVAVFGYGSFITVLINFLILAFIIFLMVKFINNLRKPAE AAPAAPPPPPEDVLLLREIRDSLKNSPR
Uniprot No.

Target Background

Function

This large-conductance mechanosensitive channel (mscL) from Burkholderia phytofirmans is a membrane channel that opens in response to membrane stretch. It may play a role in regulating cellular osmotic pressure changes.

Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Burkholderia phytofirmans and its ecological significance?

Burkholderia phytofirmans is a bacterium belonging to the genus Burkholderia, which consists of phylogenetically closely related species known for their metabolic versatility. The genus Burkholderia contains at least 86 species that demonstrate remarkable ecological adaptability . B. phytofirmans is classified within Burkholderia group A according to phylogenetic analyses .

Ecologically, B. phytofirmans plays significant roles in plant-bacterial interactions. It is considered a plant-beneficial strain, in contrast to some pathogenic Burkholderia species. Research has shown that plant-beneficial Burkholderia strains, including B. phytofirmans, possess oxalotrophy (the ability to use oxalate as a carbon source), which appears to be important for their rhizosphere competence . Experiments with B. phytofirmans have demonstrated that oxalate degradation provides a significant advantage in root colonization, highlighting its importance in plant-bacterial interactions .

Burkholderia species in general are ubiquitously present in soil environments and are involved in numerous ecological processes including decomposition of organic matter, detoxification of pollutants, and nitrogen fixation . They can establish various types of relationships with plants, fungi, and animals, ranging from antagonistic to mutualistic or symbiotic associations .

How is recombinant B. phytofirmans mscL protein produced and characterized?

According to the search results, recombinant B. phytofirmans mscL protein is produced using heterologous expression in E. coli . The specific production process involves:

  • Gene cloning: The mscL gene (Bphyt_1871) from B. phytofirmans is cloned into an expression vector.

  • Fusion protein design: The construct includes an N-terminal His-tag to facilitate purification.

  • Expression: The protein is expressed in E. coli as a recombinant full-length protein (amino acids 1-148) .

The resulting protein is characterized by:

  • Full amino acid sequence verification

  • SDS-PAGE analysis showing >90% purity

  • Proper folding assessment (although specific methods are not detailed in the search results)

The recombinant protein is typically supplied as a lyophilized powder in a storage buffer containing Tris/PBS with 6% trehalose at pH 8.0 . For reconstitution, it is recommended to use deionized sterile water to a concentration of 0.1-1.0 mg/mL, with the addition of 5-50% glycerol for long-term storage .

How does B. phytofirmans mscL compare to mechanosensitive channels from other bacterial species?

Comparative analysis of mscL proteins across bacterial species can provide insights into evolutionary conservation and functional specialization. Though the search results do not offer direct comparisons, several observations can be made:

Genomic analyses reveal that B. phytofirmans is phylogenetically related to other Burkholderia species. Synteny analysis shows that B. phytofirmans PsJN shares 67.97% coding sequence synteny with B. terrae BS001 , suggesting conservation of genetic organization across related species.

Species% CDS Synteny with B. terrae BS001
B. phymatum STM81576.78%
B. graminis C4D1M69.47%
B. phytofirmans PsJN67.97%
B. kururiensis M13064.79%
B. cenocepacia AU 105658.66%
B. pseudomallei K9624358.1%
B. mallei ATCC 2334455.49%
B. vietnamiensis G451.34%

Table 1: Comparative coding sequence synteny across Burkholderia species

This genomic context provides a framework for understanding how mscL proteins might vary across the Burkholderia genus and beyond.

What experimental approaches are most effective for studying mscL channel function?

Several experimental approaches are particularly effective for studying the function of mechanosensitive channels like mscL:

  • Electrophysiology: Patch-clamp techniques allow direct measurement of channel activity. This approach can measure:

    • Single-channel conductance

    • Gating kinetics in response to membrane tension

    • Ion selectivity properties

  • Reconstitution experiments: The recombinant protein can be incorporated into:

    • Liposomes for bulk functional assays

    • Giant unilamellar vesicles (GUVs) for microscopy and patch-clamp

    • Planar lipid bilayers for electrophysiological recordings

  • Fluorescence-based assays: These can monitor:

    • Channel opening via release of fluorescent dyes from liposomes

    • Conformational changes using environment-sensitive fluorophores

    • Protein-lipid interactions using labeled lipids

  • Mutagenesis studies: Systematic mutation of key residues can identify:

    • Tension-sensing domains

    • Gating regions

    • Lipid interaction sites

  • Computational modeling: Molecular dynamics simulations can predict:

    • Channel conformational changes during gating

    • Effects of membrane composition on channel function

    • Impact of specific mutations on channel properties

For studying recombinant B. phytofirmans mscL specifically, researchers should consider the storage and handling recommendations provided with the protein: store at -20°C/-80°C, avoid repeated freeze-thaw cycles, and use working aliquots at 4°C for up to one week .

What role might mscL play in B. phytofirmans' interactions with plants?

B. phytofirmans is known to establish beneficial interactions with plants, and its mscL channel may contribute to these interactions in several ways:

  • Osmotic adaptation during colonization: As B. phytofirmans colonizes different plant tissues, it encounters varying osmotic environments. The mscL channel likely helps the bacterium adapt to these changing conditions, particularly during initial colonization of root surfaces where osmotic fluctuations can be significant.

  • Stress response coordination: Research has shown that plant-beneficial Burkholderia strains possess specific metabolic capabilities, such as oxalotrophy, that are important for plant interactions . MscL channels may coordinate with these metabolic systems during environmental stress responses.

  • Biofilm formation and maintenance: Though not explicitly mentioned in the search results, mechanosensitive channels often play roles in bacterial biofilm formation, which is important for root colonization.

  • Environmental sensing: The mscL protein could function as part of a larger sensing system that allows B. phytofirmans to detect and respond to mechanical and osmotic cues from the plant environment.

Experimental evidence shows that B. phytofirmans with functioning oxalate degradation capability has a significant advantage in root colonization compared to mutant strains . While this specific research focused on oxalotrophy rather than mscL function, it demonstrates how specific bacterial capabilities contribute to plant-microbe interactions.

What are the optimal conditions for storing and reconstituting recombinant B. phytofirmans mscL?

According to the product information in the search results, the following storage and reconstitution protocols are recommended for recombinant B. phytofirmans mscL:

Storage conditions:

  • Store the lyophilized protein at -20°C or -80°C upon receipt

  • Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

  • The protein is typically supplied in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0

Reconstitution protocol:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (with 50% being the default recommendation) for long-term storage

  • Prepare small aliquots to avoid repeated freeze-thaw cycles

For functional studies, additional steps may be required:

  • Detergent solubilization may be necessary for incorporation into membrane mimetic systems

  • Buffer exchange might be needed depending on the experimental setup

  • The His-tag can be maintained or cleaved depending on the application

What membrane mimetic systems are most suitable for functional studies of mscL?

Several membrane mimetic systems can be employed for functional studies of mechanosensitive channels like mscL, each with advantages for specific applications:

  • Liposomes: Spherical lipid bilayers that can incorporate mscL proteins

    • Advantages: Simple preparation, control over lipid composition, suitable for bulk assays

    • Applications: Dye release assays, cryo-EM studies, osmotic shock experiments

    • Recommended lipids: Mixtures mimicking bacterial membranes (e.g., POPE/POPG)

  • Giant Unilamellar Vesicles (GUVs):

    • Advantages: Large size allows microscopic visualization and patch-clamping

    • Applications: Single-channel electrophysiology, fluorescence microscopy

    • Preparation methods: Electroformation, gentle hydration, or emulsion transfer

  • Planar Lipid Bilayers:

    • Advantages: Excellent electrical access to both membrane sides

    • Applications: Detailed electrophysiological characterization

    • Considerations: More technically challenging, require specialized equipment

  • Nanodiscs:

    • Advantages: Defined size, stable in solution without detergents

    • Applications: Structural studies, biochemical assays

    • Composition: Lipid bilayer disc stabilized by membrane scaffold proteins

  • Polymer-supported Bilayers:

    • Advantages: Mechanical stability, compatibility with surface-sensitive techniques

    • Applications: AFM, SPR, TIRF microscopy

    • Considerations: Potential interaction between polymer cushion and protein

For the recombinant B. phytofirmans mscL described in the search results , liposomes or GUVs would be most appropriate for initial functional characterization, as these systems allow for both ensemble measurements and single-channel recordings.

How can mutagenesis approaches be used to study mscL structure-function relationships?

Mutagenesis approaches offer powerful tools for investigating the structure-function relationships of mscL channels:

  • Site-directed mutagenesis:

    • Target specific amino acids predicted to be involved in:

      • Channel gating (hydrophobic constriction sites)

      • Tension sensing (lipid-facing residues)

      • Subunit interactions (interface residues)

    • Methods: PCR-based mutagenesis of the recombinant construct followed by expression and functional analysis

  • Cysteine scanning mutagenesis:

    • Systematically replace residues with cysteine for subsequent labeling

    • Applications:

      • Accessibility studies using thiol-reactive probes

      • Site-specific fluorescent labeling for FRET studies

      • Cross-linking experiments to assess proximity relationships

  • Deletion and truncation analysis:

    • Remove specific domains to assess their functional contribution

    • Examples:

      • N-terminal or C-terminal truncations

      • Loop region modifications

      • Transmembrane domain alterations

  • Functional assessment of mutants:

    • Electrophysiological characterization (patch-clamp)

    • Fluorescence-based assays (dye release from liposomes)

    • Growth/survival assays under osmotic stress

    • Structural analysis (CD spectroscopy, crystallography)

For the B. phytofirmans mscL specifically, mutagenesis studies could target residues that differ from well-characterized mscL proteins from other species, potentially revealing adaptations specific to this plant-associated bacterium's lifestyle.

How can recombinant B. phytofirmans mscL be used to study bacterial adaptation to environmental stresses?

Recombinant B. phytofirmans mscL provides a valuable tool for studying bacterial adaptation to environmental stresses:

  • Comparative stress response studies:

    • Compare mscL function across Burkholderia species from different ecological niches

    • Assess how mscL properties correlate with habitat-specific stresses

    • Investigate potential adaptations in plant-associated versus free-living strains

  • Plant-microbe interaction models:

    • Use purified mscL to study responses to plant-derived osmolytes

    • Investigate how rhizosphere conditions affect channel function

    • Develop biosensors based on mscL to monitor osmotic conditions in plant-associated environments

  • Climate change adaptation research:

    • Study how mscL function responds to temperature extremes

    • Assess channel behavior under drought-mimicking conditions

    • Investigate interactions between osmotic and other environmental stressors

  • Synthetic biology applications:

    • Engineer mscL variants with altered gating properties for controlled solute release

    • Develop stress-responsive bacterial systems using mscL as a sensing component

    • Create tunable osmoregulatory systems for biotechnology applications

The recombinant protein's availability with a His-tag facilitates purification and subsequent incorporation into various experimental systems for these applications.

What is known about the genetic regulation of mscL expression in Burkholderia species?

  • Genomic context: The mscL gene in B. phytofirmans is identified as Bphyt_1871 , providing a starting point for analyzing its genomic neighborhood and potential regulatory elements.

  • Comparative genomics: Related Burkholderia species show varying degrees of genomic synteny , suggesting potential conservation of regulatory mechanisms across the genus.

  • Stress response regulation: In most bacteria, mechanosensitive channels are typically regulated as part of stress response pathways, often involving:

    • Osmotic stress response regulons

    • General stress response sigma factors

    • Post-transcriptional regulation mechanisms

  • Environmental adaptation: Given B. phytofirmans' lifestyle as a plant-associated bacterium, its mscL regulation might be integrated with:

    • Plant interaction signaling pathways

    • Biofilm formation regulatory networks

    • Environmental sensing systems

Future research directions could include:

  • Promoter analysis of the B. phytofirmans mscL gene

  • Transcriptomic studies under various osmotic conditions

  • Comparison of expression patterns during free-living versus plant-associated growth

  • Investigation of potential small RNA regulators of mscL expression

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.