Recombinant Burkholderia phytofirmans Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Description

Biological Function and Mechanism

YidC operates via two distinct pathways:

  1. Sec-independent insertion: Directly integrates single-spanning membrane proteins (e.g., Pf3 coat protein) by stabilizing transmembrane helices through electrostatic and hydrophobic interactions .

  2. Sec-YidC cooperativity: Assists the Sec translocon in folding multi-pass membrane proteins (e.g., respiratory chain complexes) .

Key functional attributes include:

  • Hydrophilic groove: Binds charged residues of substrate proteins (e.g., Pf3 D7/R72 salt bridge) .

  • Lipid scramblase activity: Perturbs lipid asymmetry, enhancing membrane adaptability during insertion .

  • Cytoplasmic domain interactions: Critical for substrate recognition and species-specific SecY binding .

Functional Insights from Burkholderia phytofirmans YidC

  • Chimera studies: Swapping cytoplasmic domains between YidC paralogs (e.g., YidC1/YidC2) revealed domain-specific roles in metal ion homeostasis and stress adaptation .

  • YibN interaction: The recently identified YibN protein enhances YidC-dependent insertion of substrates like M13 procoat and ATP synthase subunit c by ~30% in vitro .

Comparative Analysis with Homologs

FeatureB. phytofirmans YidCE. coli YidCB. halodurans YidC
TM Helices555
Periplasmic DomainAbsentLarge P1/P2 domainsAbsent
Substrate SpecificityPf3 coat, F0cFtsQ, CyoAM13 procoat
Co-factor DependencyYibN enhances activitySecYEG-dependent foldingSec-independent

Applications in Biotechnology

  • Membrane protein production: Used to reconstitute in vitro insertion assays for studying Sec-independent mechanisms .

  • Drug target exploration: YidC’s role in bacterial respiration makes it a candidate for antibiotic development .

Challenges and Future Directions

  • Mechanistic ambiguity: The exact sequence of substrate translocation (e.g., lateral vs. vertical release) remains unresolved .

  • Structural plasticity: How YidC transitions between insertase and chaperone conformations requires further study .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please specify your preferred tag type for prioritized development.
Synonyms
yidC; Bphyt_3986; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-552
Protein Length
full length protein
Species
Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN) (Burkholderia phytofirmans)
Target Names
yidC
Target Protein Sequence
MDIKRTVLWVIFFMSAVMLFDNWQRDHGRPSMFFPSATPTKTVGSAAPGTTTPGTQPADL PATNAAAPGNAPAATQSQLVKFNTDVYSGEIDTRGGTLSKLSLVNKGDGKQPDLVITLFD RTANHTYLARTGLLGGDFPNHNDIYTPLPNQQHDLTGDEKSFQLSFESPVKGGVKVIKTY TFTRGSYVIGVDTKIQNVGTAPVTPSVYMELVRDDQPVETPRFSHTFIGPAVYTDQHHFQ KMTFGDIDKNKQDYATSADNGWIAMVQHYFASAWIPQQGVKRDIYVEKIDPALYRVGVKE PVPTIAPGQTVDVSARLFAGPEEERMLEGIAPGLELVKDYGWVTIIAKPLFWLLEKIHSY VGNWGWSIVLLTLLIKAVFFPLSAASYKSMARMKAITPRMQALRERFKGDPQKMNSALME LYKTEKVNPFGGCLPVVIQIPVFISLYWVLLSSVEMRGAPWILWIHDLSQQDPFFILPVL MAVSMFLQTKLNPTPPDPVQAKMMMFMPIAFSVMFFFFPAGLVLYYVVNNVLSIAQQYYI TRMMGQTKAKAA
Uniprot No.

Target Background

Function
Essential for the insertion, proper folding, and complex formation of integral membrane proteins within the cell membrane. It plays a role in the integration of membrane proteins, both those dependent and independent of the Sec translocase complex, and certain lipoproteins. It also facilitates the folding of multi-spanning membrane proteins.
Database Links
Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Burkholderia phytofirmans Membrane protein insertase YidC?

Membrane protein insertase YidC (yidC) in Burkholderia phytofirmans is a crucial membrane protein responsible for facilitating the insertion and folding of proteins into cellular membranes. The full-length protein consists of 552 amino acids and is commonly expressed with tags (such as His-tag) for purification purposes . YidC belongs to a highly conserved family of membrane protein insertases that play essential roles in membrane protein biogenesis across bacteria, archaea, and eukaryotes .

What is the evolutionary significance of YidC?

YidC has significant evolutionary importance as it appears to share a common ancestry with SecY, a core component of the general secretory pathway. Structural and functional analyses suggest that SecY may have evolved from a dimeric YidC homologue through gene duplication and fusion. Both proteins share a structural core composed of a membrane-embedded H1/4/5 bundle and a peripheral H0 brace, despite their different current functions . This evolutionary relationship provides insight into the ancient origins of protein translocation machinery.

What are the key structural features of B. phytofirmans YidC?

Based on the available sequence data, B. phytofirmans YidC (UniProt: B2T7U1) is a 552-amino acid protein with several notable structural features:

  • Multiple transmembrane domains characteristic of membrane insertases

  • A hairpin-interrupted three-TMH (transmembrane helix) motif that is conserved across the YidC family

  • Hydrophilic grooves that facilitate membrane protein insertion

  • A peripheral H0 brace that plays an important structural role

The amino acid sequence shows characteristic hydrophobic regions consistent with membrane integration, as well as more hydrophilic regions that likely form functionally important grooves within the membrane environment.

How does B. phytofirmans YidC compare structurally to other YidC homologs?

While specific structural comparisons of B. phytofirmans YidC with other homologs are not directly addressed in the search results, evolutionary analysis indicates that the core structural elements of YidC proteins are highly conserved. The hairpin-interrupted three-TMH motif found in YidC is strikingly similar across species. Research suggests that YidC can form dimers, and novel heterodimers have been discovered in archaeal and eukaryotic YidC proteins . This structural conservation reflects the essential nature of YidC's function across diverse organisms.

What is the relationship between YidC sequence and function?

The specific sequence-function relationships for B. phytofirmans YidC can be inferred from the highly conserved nature of this protein family. The full amino acid sequence provided in the search results (MDIKRTVLWVIFFMSAVMLFDNWQRDHG...) shows both hydrophobic regions typical of transmembrane domains and more hydrophilic segments that likely form functionally important regions . These hydrophilic regions within the transmembrane segments are crucial for the formation of the substrate-binding groove and the hydrophilic environment that facilitates membrane protein insertion.

What are optimal expression systems for recombinant B. phytofirmans YidC?

The available recombinant B. phytofirmans YidC has been successfully expressed in E. coli expression systems with an N-terminal His-tag . This approach allows for:

  • Efficient expression of the full-length protein (amino acids 1-552)

  • Addition of affinity tags for simplified purification

  • Expression of a membrane protein that retains its functional characteristics

When expressing membrane proteins like YidC, researchers should consider:

  • Using bacterial strains optimized for membrane protein expression

  • Temperature and induction conditions that favor proper membrane protein folding

  • Solubilization methods compatible with downstream applications

What purification methods are most effective for recombinant YidC?

Based on the product information available, recombinant B. phytofirmans YidC with His-tag can be purified to >90% purity as determined by SDS-PAGE . For membrane proteins like YidC, effective purification typically involves:

  • Cell lysis under conditions that preserve protein structure

  • Membrane fraction isolation by ultracentrifugation

  • Detergent solubilization of membrane proteins

  • Immobilized metal affinity chromatography (IMAC) using the His-tag

  • Optional additional purification steps like size exclusion chromatography

  • Quality control through SDS-PAGE and functional assays

The final product is typically stored in a buffer containing stabilizers like trehalose (6%) at pH 8.0 .

What storage conditions are recommended for maintaining YidC activity?

Optimal storage conditions for recombinant B. phytofirmans YidC include:

  • Long-term storage at -20°C/-80°C

  • Addition of 5-50% glycerol (50% being the default recommendation) to prevent freeze damage

  • Reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Avoidance of repeated freeze-thaw cycles

  • For working stocks, storage at 4°C for up to one week is recommended

These conditions help maintain the structural integrity and functional activity of the membrane protein.

How can researchers investigate YidC-mediated membrane protein insertion mechanisms?

To study the mechanisms of YidC-mediated membrane protein insertion, researchers can employ several approaches:

  • In vitro reconstitution systems: Using purified recombinant YidC reconstituted into liposomes with model substrate proteins

  • Site-directed mutagenesis: Modifying key residues to identify functional domains

  • Crosslinking studies: Identifying interaction sites between YidC and substrate proteins

  • Structural biology techniques: Cryo-EM or X-ray crystallography to determine detailed structural information

  • Computational modeling: Based on the evolutionary relationship between YidC and SecY to predict functional mechanisms

Such studies can reveal how YidC recognizes substrate proteins, how it facilitates membrane insertion, and how it coordinates with other components of the protein translocation machinery.

What is known about the role of YidC in B. phytofirmans endophytic lifestyle?

While specific studies on the role of YidC in B. phytofirmans' endophytic lifestyle are not directly addressed in the search results, we can make informed inferences:

B. phytofirmans PsJN is a well-studied bacterial endophyte that colonizes various plants and promotes plant growth . As a membrane protein insertase, YidC likely plays a critical role in:

  • Proper membrane protein integration during bacterial colonization of plant tissues

  • Assembly of transporters and surface proteins involved in plant-microbe interactions

  • Maintenance of membrane integrity under varying environmental conditions encountered during plant colonization

This is supported by transcriptome studies showing that B. phytofirmans expresses a broad array of genes while colonizing plants, indicating active protein synthesis and membrane protein integration during endophytic growth .

How does YidC coordinate with other protein translocation machinery in B. phytofirmans?

Based on evolutionary analysis, YidC likely coordinates with the Sec translocon in B. phytofirmans similar to other bacterial systems . This coordination may involve:

  • Independent insertion of some membrane proteins directly via YidC

  • Co-translational insertion with the Sec translocon, where YidC assists in the lateral release of transmembrane segments

  • Post-translational folding and assembly of membrane protein complexes

The evolutionary relationship between SecY and YidC suggests these systems may share substrates or work in concert for certain membrane proteins .

What are the major challenges in working with recombinant YidC?

Researchers working with recombinant B. phytofirmans YidC face several challenges:

  • Membrane protein expression: As with most membrane proteins, achieving high-level expression of properly folded YidC can be difficult

  • Maintaining native conformation: Ensuring the recombinant protein adopts its native structure after purification

  • Functional reconstitution: Successfully incorporating purified YidC into membrane mimetics that support its activity

  • Assay development: Creating reliable functional assays for YidC-mediated membrane insertion

  • Substrate identification: Determining the specific substrates of B. phytofirmans YidC

These challenges require careful optimization of expression conditions, purification protocols, and functional assays.

What controls should be included in YidC functional studies?

When conducting functional studies with recombinant B. phytofirmans YidC, researchers should consider several controls:

  • Inactive YidC variants: YidC with mutations in key functional residues

  • Alternative membrane insertases: Comparing YidC activity with other insertases like Sec

  • Substrate specificity controls: Testing known YidC substrates versus non-substrates

  • Detergent/lipid controls: Ensuring the membrane environment supports proper YidC function

  • Tag-free comparisons: Confirming that affinity tags do not interfere with function

These controls help validate experimental findings and distinguish specific YidC functions from non-specific effects.

How can researchers verify the proper folding and activity of recombinant YidC?

To verify that recombinant B. phytofirmans YidC is properly folded and functionally active, researchers can employ several approaches:

These complementary techniques provide comprehensive validation of recombinant YidC quality and functionality.

What are promising areas for future research on B. phytofirmans YidC?

Several promising research directions for B. phytofirmans YidC include:

  • Structural studies: Determining the high-resolution structure of B. phytofirmans YidC

  • Substrate profiling: Identifying the complete set of YidC substrates in B. phytofirmans

  • Plant-microbe interactions: Investigating the role of YidC in establishing and maintaining endophytic relationships

  • Evolutionary analyses: Further exploring the relationship between YidC and SecY

  • Stress response mechanisms: Examining how YidC function adapts to environmental stresses encountered during plant colonization

Such studies would significantly advance our understanding of membrane protein biogenesis in B. phytofirmans and its ecological importance.

How might YidC research contribute to understanding B. phytofirmans as a plant growth-promoting endophyte?

Research on B. phytofirmans YidC could enhance our understanding of this bacterium's plant growth-promoting abilities in several ways:

  • Membrane protein assembly: YidC likely facilitates the integration of transporters and receptors involved in plant-microbe signaling

  • Stress adaptation: Proper membrane protein integration via YidC may contribute to B. phytofirmans' ability to withstand environmental stresses

  • Host colonization: YidC-dependent membrane proteins may be essential for establishing endophytic relationships

  • Metabolic exchange: Transporters assembled with YidC assistance may facilitate the exchange of nutrients and signaling molecules with host plants

Understanding these processes could potentially lead to improved applications of B. phytofirmans as a biostimulant for agriculture .

What techniques are emerging for studying membrane protein insertases like YidC?

Emerging techniques that could advance research on membrane protein insertases like B. phytofirmans YidC include:

  • Cryo-electron microscopy: For high-resolution structural studies of YidC alone or in complex with substrates

  • Native mass spectrometry: To study membrane protein complexes involving YidC

  • Single-molecule techniques: To observe YidC-mediated insertion events in real-time

  • Integrative structural biology: Combining multiple techniques for comprehensive structural characterization

  • Systems biology approaches: To understand YidC in the context of the entire B. phytofirmans protein biogenesis network

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.