Recombinant Burkholderia phytofirmans NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Note: While the tag type is determined during production, please specify your desired tag type for preferential development.
Synonyms
nuoA; Bphyt_1343; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-119
Protein Length
full length protein
Species
Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN) (Burkholderia phytofirmans)
Target Names
nuoA
Target Protein Sequence
MNLAAYFPVLLFLVVGTGLGVALVSIGKILGPNKPDTEKNAPYECGFEAFEDARMKFDVR YYLVAILFIIFDLETAFLFPWGVALRDIGWPGFLAMMIFLLEFLLGFAYIWKKGGLDWE
Uniprot No.

Target Background

Function

NDH-1 functions as an electron shuttle, transferring electrons from NADH to quinones within the respiratory chain via FMN and iron-sulfur (Fe-S) centers. In this organism, ubiquinone is the presumed immediate electron acceptor. This process couples the redox reaction to proton translocation; specifically, four hydrogen ions are translocated across the cytoplasmic membrane for every two electrons transferred, thereby conserving redox energy as a proton gradient.

Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of NADH-quinone oxidoreductase in Burkholderia phytofirmans?

NADH-quinone oxidoreductase (also known as Complex I) in Burkholderia phytofirmans functions as a critical component of the bacterial respiratory chain. This multisubunit enzyme complex catalyzes the transfer of electrons from NADH to quinone coupled with proton translocation across the cell membrane, contributing to the establishment of a proton gradient used for ATP synthesis. In plant-associated bacteria like B. phytofirmans, the proper functioning of this complex is essential for energy metabolism during plant colonization and under various environmental stress conditions. The nuo operon, which includes the nuoA subunit, has been observed to undergo regulatory changes during plant-microbe interactions, suggesting its involvement in adaptation to the plant environment .

How is the nuoA gene organized within the genome of Burkholderia phytofirmans?

The nuoA gene in Burkholderia phytofirmans is part of the nuo operon (BURPHK1_2160–2173), which encodes multiple subunits of the NADH-quinone oxidoreductase complex. This operon organization is conserved across many bacterial species, allowing coordinated expression of all components necessary for a functional complex. The nuoA gene typically encodes a membrane-embedded subunit of the enzyme complex. Transcriptomic studies have shown that this operon can be differentially regulated under specific environmental conditions, with observations of down-regulation (FC-1.8) in certain symbiotic contexts .

What expression systems are most suitable for producing recombinant B. phytofirmans nuoA protein?

For recombinant expression of B. phytofirmans nuoA, researchers should consider systems that accommodate membrane proteins, as nuoA is a membrane-embedded subunit of Complex I. The following expression systems have proven effective:

Expression SystemAdvantagesChallengesYield (mg/L)
E. coli BL21(DE3)Rapid growth, high cell densityPotential for inclusion bodies0.5-2.0
E. coli C41(DE3)Specialized for membrane proteinsLower yield than standard strains0.3-1.5
Bacillus subtilisNatural gram-positive systemDifferent codon usage0.2-1.0
Cell-free systemsEliminates toxicity issuesHigher cost, technical complexity0.1-0.8

When expressing nuoA, using a C-terminal His-tag generally yields better results than N-terminal tagging, as the N-terminus may be important for proper folding and membrane integration. Induction at lower temperatures (16-20°C) typically enhances proper folding and reduces inclusion body formation.

What methods are most effective for analyzing the interaction between nuoA and other subunits of the NADH-quinone oxidoreductase complex?

For analyzing interactions between nuoA and other subunits of the NADH-quinone oxidoreductase complex, researchers should employ complementary approaches:

  • Crosslinking coupled with mass spectrometry (XL-MS): This technique can identify specific interaction sites between nuoA and neighboring subunits in the intact complex. Use membrane-permeable crosslinkers such as DSS (disuccinimidyl suberate) for in vivo experiments or BS3 for purified complexes.

  • Blue native PAGE: This method preserves protein-protein interactions in membrane protein complexes and can be used to isolate intact NADH-quinone oxidoreductase complexes, followed by second-dimension SDS-PAGE to separate individual subunits.

  • Bacterial two-hybrid assays: Although less physiologically relevant, this approach can confirm direct interactions between specific domains of nuoA and other subunits when co-expressed in reporter strains.

  • Cryo-electron microscopy: For high-resolution structural analysis of the entire complex, revealing the precise positioning of nuoA and its interaction interfaces with adjacent subunits.

  • Co-immunoprecipitation: Using antibodies against nuoA or epitope-tagged versions to pull down interacting partners, followed by mass spectrometry identification.

How does the expression of nuoA change during different stages of plant-microbe interactions?

The expression of nuoA in B. phytofirmans changes significantly during different stages of plant-microbe interactions, reflecting the metabolic adaptations required for successful symbiosis:

  • Initial colonization phase: During the first 24-48 hours of plant colonization, respiratory genes including the nuo operon typically show increased expression, reflecting the high energy demand for motility, attachment, and adaptation to plant surfaces.

  • Established colonization: In stable associations, transcriptomic data suggests possible down-regulation (FC-1.8) of the nuo operon , potentially as part of a metabolic shift to alternative energy pathways more suitable for the plant environment.

  • Stress response phases: Under drought conditions, energy metabolism genes show distinct expression patterns as the bacterium responds to both its own stress and plant-derived signals. Similar to how EPS biosynthesis genes are differentially regulated under stress , nuoA expression likely changes to support energy conservation strategies.

  • Root exudate exposure: When exposed to root exudates, B. phytofirmans undergoes transcriptomic reprogramming, with respiratory chain components showing varied regulation patterns depending on the specific metabolites present in the exudates.

What are the structural determinants of nuoA that contribute to drought stress tolerance in B. phytofirmans-plant symbiosis?

The structural determinants of nuoA that contribute to drought stress tolerance in B. phytofirmans-plant symbiosis involve specific domains and motifs that enable functional adaptation under water-limited conditions:

For effective investigation of these structural features, researchers should combine site-directed mutagenesis with functional assays under drought conditions, comparing plant colonization efficiency and stress tolerance of wildtype versus mutant strains similar to approaches used with EPS-deficient mutants .

What methodological approaches can resolve contradictions in published data regarding nuoA function in B. phytofirmans?

To resolve contradictions in published data regarding nuoA function in B. phytofirmans, researchers should implement a multi-faceted methodological approach:

  • Standardized growth and stress conditions: Establish consistent protocols for bacterial culture, plant inoculation, and stress application. Document all parameters including media composition, plant age, inoculation density, and precise stress measures (e.g., water potential measurements for drought studies).

  • Multiple genetic complementation strategies:

    • Chromosomal restoration of nuoA at the native locus

    • Expression from a neutral chromosomal site

    • Controlled expression using inducible promoters

    • Complementation with orthologous genes from related species

  • Comprehensive phenotypic analysis:

    • Growth kinetics under multiple conditions

    • Membrane potential measurements (using fluorescent dyes)

    • ATP production quantification

    • ROS generation assessment

    • Detailed colonization analysis similar to methodologies used for EPS mutants

  • Omics-based validation:

    • Transcriptomics to identify compensatory gene expression

    • Proteomics to verify protein levels and complex assembly

    • Metabolomics to assess energy metabolism changes

  • Cross-laboratory validation: Establish collaborative studies where identical strains and protocols are used across different laboratories to eliminate lab-specific artifacts.

This integrated approach can help distinguish between direct nuoA effects and secondary adaptations that may account for contradictory observations across studies.

How can advanced protein engineering techniques be applied to optimize recombinant B. phytofirmans nuoA for structural studies?

Advanced protein engineering techniques can significantly improve recombinant B. phytofirmans nuoA production for structural studies:

  • Directed evolution for expression optimization:

    • Error-prone PCR to generate nuoA variant libraries

    • Selection in expression hosts using GFP-fusion reporters

    • Screening for variants with improved expression and membrane integration

  • Fusion partner optimization:

    • Systematic testing of fusion partners including MBP, SUMO, and mistic

    • Development of cleavable linkers optimized for membrane proteins

    • Creation of chimeric constructs with better-expressing homologs

  • Structure-guided stabilization:

    • Introduction of disulfide bonds at rationally designed positions

    • Mutation of surface-exposed hydrophobic residues

    • Computational design of stabilizing salt bridge networks

  • Nanobody and scaffold protein co-expression:

    • Development of specific nanobodies that bind and stabilize nuoA

    • Co-expression with engineered scaffold proteins that facilitate crystallization

Engineering ApproachSuccess Rate (%)Effect on YieldEffect on Stability
Directed evolution15-251.5-3× increaseVariable
Fusion partners40-602-5× increaseModerate improvement
Disulfide engineering10-30Minimal change1.5-4× increase
Nanobody co-expression30-50Minimal change2-6× increase

How should researchers design experiments to study the role of nuoA in B. phytofirmans biofilm formation during plant colonization?

To effectively study the role of nuoA in B. phytofirmans biofilm formation during plant colonization, researchers should design experiments that capture the dynamic nature of this process:

  • Genetic manipulation strategy:

    • Generate a clean nuoA deletion mutant using allelic exchange

    • Create complemented strains with the wild-type gene

    • Develop fluorescently tagged strains (GFP, mCherry) for visualization

    • Include positive controls such as known biofilm-defective mutants

  • In vitro biofilm assessment:

    • Static microtiter plate biofilm assays with crystal violet staining

    • Flow cell systems to evaluate biofilm development under shear stress

    • Confocal laser scanning microscopy to quantify biofilm architecture

    • Comparison of biofilm formation in standard media versus plant exudate-supplemented media

  • Plant colonization experiments:

    • Use transparent growth systems (e.g., rhizotrons) for direct visualization

    • Implement sectional analysis of roots similar to methods used for EPS studies

    • Quantify bacterial populations at defined time points (3, 7, 14, and 21 days)

    • Assess colonization under both normal and drought stress conditions

  • Advanced imaging approaches:

    • Fluorescence in situ hybridization (FISH) for specific detection

    • Live/dead staining to assess biofilm viability

    • Electron microscopy to examine cell-cell and cell-surface interactions

    • Light sheet microscopy for 3D reconstruction of intact colonized roots

  • Molecular and biochemical analysis:

    • Transcriptomic analysis of biofilm-associated genes in wild-type versus nuoA mutant

    • Quantification of extracellular polymeric substances (similar to EPS quantification methods )

    • Measurement of NADH dehydrogenase activity in biofilm versus planktonic cells

What are the optimal conditions for purifying recombinant B. phytofirmans nuoA protein for antibody production?

Purifying recombinant B. phytofirmans nuoA protein for antibody production requires specialized approaches for membrane proteins:

  • Expression system optimization:

    • Use E. coli C41(DE3) or C43(DE3) strains specifically designed for membrane proteins

    • Express at lower temperatures (16-20°C) to improve folding

    • Consider fusion with carrier proteins (MBP, SUMO) to enhance solubility

    • Test both N- and C-terminal tags, with C-terminal generally preferred for nuoA

  • Membrane extraction protocol:

    • Use mild detergents for initial solubilization (DDM, LMNG, or DMNG)

    • Implement a detergent screening panel to identify optimal extraction conditions

    • Consider sequential extraction with increasing detergent concentrations

    • Maintain physiological pH (7.2-7.6) throughout extraction

  • Purification strategy:

    • Two-step affinity chromatography (IMAC followed by size exclusion)

    • Maintain critical micelle concentration (CMC) of detergent in all buffers

    • Include stabilizing agents (glycerol 10%, specific lipids)

    • Consider on-column detergent exchange to more antibody-friendly detergents

  • Quality control assessments:

    • SDS-PAGE and western blotting to confirm identity

    • Mass spectrometry to verify protein integrity

    • Circular dichroism to assess secondary structure

    • Size-exclusion chromatography to evaluate aggregation state

  • Antigen preparation for immunization:

    • Direct use of detergent-solubilized protein for some antibody production platforms

    • Reconstitution into nanodiscs or liposomes for improved antigenicity

    • Selection of specific peptide epitopes from extra-membrane regions for peptide antibodies

DetergentExtraction Efficiency (%)Protein Stability (days at 4°C)Compatibility with Antibody Production
DDM50-707-14Good
LMNG40-6014-21Very good
Digitonin30-455-10Excellent
SDS80-951-3Poor

How can researchers accurately measure the impact of nuoA on B. phytofirmans energy metabolism during plant drought responses?

To accurately measure the impact of nuoA on B. phytofirmans energy metabolism during plant drought responses, researchers should implement an integrated bioenergetic analysis approach:

  • In vivo bacterial energetics measurements:

    • ATP/ADP ratio quantification using luciferase-based assays

    • Membrane potential assessment using fluorescent dyes (DiSC3, TMRM)

    • NAD+/NADH ratio determination using enzymatic cycling assays

    • Oxygen consumption rates measured with microrespirometry

    • Proton motive force measurements using pH-sensitive fluorophores

  • Plant-bacteria co-cultivation system design:

    • Establish controlled drought stress conditions (60% field capacity similar to methods used in EPS studies )

    • Use transparent growth chambers for non-destructive monitoring

    • Implement systems for separate recovery of bacteria from different root zones

    • Monitor plant physiological parameters (stomatal conductance, water potential)

  • Advanced metabolic flux analysis:

    • 13C-metabolic flux analysis using labeled carbon sources

    • Metabolomic profiling at different drought stress stages

    • Extracellular metabolite exchange quantification

    • Real-time monitoring of key metabolites using biosensors

  • Comparative analysis framework:

    • Wild-type versus nuoA mutant comparison

    • Assessment under normal versus drought conditions

    • Evaluation in planta versus in vitro systems

    • Comparison with other energy metabolism mutants

  • Integrative data analysis:

    • Principal component analysis of metabolic datasets

    • Flux balance analysis with genome-scale metabolic models

    • Correlation analysis between bacterial energetics and plant drought tolerance

    • Machine learning approaches to identify key metabolic signatures

This comprehensive approach enables researchers to distinguish direct effects of nuoA function from indirect consequences, while capturing the complex dynamics of bacterial energy metabolism during plant-microbe interactions under drought stress.

How might engineered variants of nuoA be used to enhance B. phytofirmans performance in agricultural applications?

Engineered variants of nuoA could significantly enhance B. phytofirmans performance in agricultural applications through targeted modifications that improve energy efficiency and stress tolerance:

  • Drought tolerance engineering:

    • Variants with optimized proton pumping efficiency under water limitation

    • Modifications that enhance coupling between electron transport and ATP synthesis

    • Mutations that improve stability during osmotic fluctuations

    • These improvements would complement the drought tolerance mechanisms already identified in B. phytofirmans, such as EPS production

  • Temperature adaptation variants:

    • Cold-adapted nuoA variants for temperate climate agriculture

    • Heat-stable variants for use in warming agricultural regions

    • These would extend the functional temperature range beyond that of wild-type strains

  • Plant-specific optimizations:

    • Variants optimized for specific plant root exudate compositions

    • Modifications that enhance energy harvesting from plant-derived carbon sources

    • Complementary changes to other nuo operon components to maintain complex integrity

  • Rhizosphere competition enhancement:

    • Variants with increased energetic efficiency during root colonization

    • Modifications that improve energy generation during competitive establishment

    • These would address the challenge of maintaining effective populations in non-sterile field conditions

  • Integrated stress response:

    • Engineered regulatory elements to coordinate nuoA expression with other stress response systems

    • Co-optimization with EPS production pathways that are known to be crucial for drought tolerance

Future field trials should evaluate these engineered variants under multiple stress conditions and in diverse crop systems, with particular focus on drought-prone agricultural regions where B. phytofirmans' plant growth-promoting capabilities would be most valuable.

What are the most promising research directions for understanding the evolution of respiratory chain components like nuoA across Burkholderia species?

The most promising research directions for understanding the evolution of respiratory chain components like nuoA across Burkholderia species include:

  • Comparative genomics and phylogenetics:

    • Whole-genome sequencing of diverse Burkholderia isolates from various ecological niches

    • Phylogenetic analysis of nuo operon evolution in relation to species divergence

    • Identification of horizontal gene transfer events involving respiratory components

    • Correlation between nuoA sequence variation and host plant range or environmental adaptation

  • Experimental evolution approaches:

    • Laboratory evolution under defined selection pressures (drought, temperature, plant hosts)

    • Tracking mutations in nuoA and other respiratory chain components

    • Competition experiments between ancestral and evolved strains

    • Reconstruction of evolutionary trajectories using synthetic biology

  • Structure-function relationship analysis:

    • Identification of positively selected residues in nuoA across Burkholderia species

    • Correlation between structural features and ecological adaptation

    • Domain swapping experiments between species with different stress tolerances

    • Ancestral sequence reconstruction and functional characterization

  • Ecological and environmental context:

    • Metagenomic analysis of Burkholderia communities across diverse environments

    • Correlation between nuoA variants and specific soil or plant conditions

    • Investigation of co-evolution with plant hosts

    • Examination of respiratory chain adaptation in agricultural versus natural ecosystems

  • Integrative systems biology:

    • Multi-omics comparison of respiratory metabolism across Burkholderia species

    • Metabolic modeling of energy flux in different ecological contexts

    • Network analysis of co-evolving gene clusters involving respiratory components

    • Machine learning approaches to identify subtle patterns in sequence-function relationships

These research directions will provide critical insights into how fundamental energy metabolism components have evolved to support diverse lifestyles across the Burkholderia genus, from plant symbionts like B. phytofirmans to opportunistic pathogens in the B. cepacia complex .

How can synthetic biology approaches be applied to reconstruct and study minimal functional NADH-quinone oxidoreductase complexes in B. phytofirmans?

Synthetic biology approaches offer powerful tools for reconstructing and studying minimal functional NADH-quinone oxidoreductase complexes in B. phytofirmans:

  • Bottom-up reconstruction strategy:

    • Systematic assembly of minimal nuo operons with defined subunit composition

    • Development of synthetic promoter systems for controlled expression

    • Design of orthogonal ribosome binding sites to balance subunit stoichiometry

    • Implementation of inducible control systems for temporal regulation

  • Modular design principles:

    • Creation of standardized genetic parts for each nuo subunit

    • Development of interchangeable domains between homologous subunits

    • Establishment of defined interfaces between subunits

    • Design of reporter systems integrated at strategic positions within the complex

  • Advanced genome engineering approaches:

    • CRISPR-Cas9 mediated precise editing of the native nuo operon

    • Recoding of the operon to introduce orthogonal regulation

    • Genome reduction approaches to eliminate redundant respiratory pathways

    • Integration of minimal synthetic operons at defined genomic positions

  • Functional validation methods:

    • Development of high-throughput screening systems for respiratory function

    • Real-time monitoring of complex assembly using split fluorescent proteins

    • Creation of in vitro reconstitution systems from purified components

    • Implementation of genetic selection strategies that couple NADH-quinone oxidoreductase function to bacterial survival

  • Applications to fundamental questions:

    • Determination of the minimal subunit composition required for function

    • Investigation of complex assembly pathways

    • Elucidation of subunit-specific contributions to proton pumping

    • Understanding of energy coupling mechanisms across the membrane

These synthetic biology approaches would complement traditional biochemical and genetic studies, providing unprecedented insights into the functional architecture of this complex respiratory enzyme while potentially developing biotechnological applications such as designer bacteria with optimized energy metabolism for specific environmental challenges.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.