Recombinant Burkholderia phytofirmans NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Protein Characteristics and Biochemical Properties

The recombinant nuoK protein is derived from Burkholderia phytofirmans (formerly classified as Paraburkholderia phytofirmans) and exhibits the following features:

ParameterDetails
UniProt IDB2T2F7
Gene NamenuoK
Protein LengthFull-length (1–101 amino acids)
Amino Acid SequenceMLTLAHYLVLGAILFAISIVGIFLNRRNVIIILMAIELMLLAVNTNFVAFSHYLGDVHGQ IFVFFVLTVAAAEAAIGLAILVTLFRSLDTINVEDLDQLKG
Expression SystemE. coli
TagN-terminal His-tag
Purity>90% (SDS-PAGE) , >85% (SDS-PAGE)
Storage BufferTris/PBS-based buffer with 6% trehalose (pH 8.0) ; 50% glycerol
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL) with 5–50% glycerol

Functional Role in the NDH-1 Complex

The NDH-1 complex in Burkholderia phytofirmans catalyzes electron transfer from NADH to quinones (e.g., ubiquinone), coupled with proton translocation across the cytoplasmic membrane. Subunit K (nuoK) is part of the membrane-associated fragment of NDH-1, which includes subunits NuoA, H, J, K, L, M, and N .

Key Functions:

  • Electron Transfer: Facilitates redox reactions via FMN and iron-sulfur centers .

  • Proton Pumping: Contributes to proton gradient formation, conserving energy for ATP synthesis .

  • Superfamily Affiliation: Belongs to the NAD(P)H quinone oxidoreductase superfamily, sharing structural and functional similarities with azoreductases .

Production Methods

Recombinant nuoK is typically expressed in E. coli and purified via affinity chromatography (His-tag) . The protein is available in lyophilized or liquid forms, stabilized with trehalose or glycerol to prevent degradation .

Applications in Research

ApplicationDetails
ELISA AssaysUsed as an antigen in enzyme-linked immunosorbent assays to detect anti-nuoK antibodies .
Structural StudiesAnalyzed via X-ray crystallography and cryo-EM to elucidate NDH-1 architecture .
Functional AnalysisStudied in reconstituted membrane systems to assess proton translocation efficiency .

Technical Considerations

  • Storage: Lyophilized powders are stored at -20°C/-80°C; liquid forms require -20°C storage .

  • Stability: Repeated freeze-thaw cycles degrade activity; working aliquots should be stored at 4°C for ≤1 week .

  • Reconstitution: Glycerol (5–50%) is recommended to enhance stability during long-term storage .

Comparative Analysis with Related Subunits

SubunitFunctionUniProt IDSource Organism
NuoKMembrane-embedded, proton translocationB2T2F7Burkholderia phytofirmans
NuoBPeripheral subunit, quinone bindingB2T2E8Burkholderia phytofirmans
NuoACore transmembrane subunitP0AFC3E. coli

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery information.
All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, briefly centrifuge the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
nuoK; Bphyt_1353; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN) (Burkholderia phytofirmans)
Target Names
nuoK
Target Protein Sequence
MLTLAHYLVLGAILFAISIVGIFLNRRNVIIILMAIELMLLAVNTNFVAFSHYLGDVHGQ IFVFFVLTVAAAEAAIGLAILVTLFRSLDTINVEDLDQLKG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. In this species, ubiquinone is considered the immediate electron acceptor for the enzyme. The enzyme couples the redox reaction with proton translocation, where for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane. This process conserves the redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Burkholderia phytofirmans and why is it significant in research?

Burkholderia phytofirmans (recently reclassified as Paraburkholderia phytofirmans) strain PsJN is a gram-negative, non-sporulating, motile bacterium originally isolated from onion roots infected with the mycorrhizal fungus Glomus vesiculiferum . This bacterium has garnered significant research interest due to several key features:

  • It establishes both rhizospheric and endophytic colonization in various plants including potato, switchgrass, tomato, Arabidopsis, maize, lupin, and grapevine

  • It demonstrates remarkable plant growth-promoting abilities in numerous plant species

  • It can induce plant resistance against both biotic and abiotic stresses

  • It possesses a unique colonization pattern, migrating from rhizoplane to aerial tissues

The strain has become an established model for studying plant-associated endophytic bacteria due to its ecological competence and beneficial effects on plant hosts .

What is NADH-quinone oxidoreductase and what role does subunit K play?

NADH-quinone oxidoreductase (also known as Complex I or NADH dehydrogenase) is a key enzyme in cellular respiration, particularly in energy metabolism. While the search results don't specifically detail the nuoK subunit in Burkholderia phytofirmans, we can understand its general function from related research on NADH:quinone oxidoreductases:

  • These enzymes catalyze the oxidation of NADH to NAD+ and transfer electrons to quinones in the respiratory chain

  • They play essential roles in cellular energy production and redox balance maintenance

  • In bacterial systems, these enzymes can oxidize NADH with various electron acceptors and contribute to the organism's metabolic versatility

The subunit K (nuoK) is typically a membrane-embedded component of the enzyme complex, contributing to proton translocation across the membrane during the electron transfer process.

What are the optimal expression systems for producing recombinant Burkholderia phytofirmans nuoK?

Based on approaches used for similar NADH:quinone oxidoreductases, the following expression methodology is recommended:

  • Vector selection: Use pET-based expression vectors containing N-terminal His6-tag for efficient purification

  • Host strain: E. coli BL21(DE3) or similar strains are suitable for expression of membrane proteins

  • Expression conditions:

    • Initial culture growth at 37°C until OD600 reaches 0.6-0.8

    • Induction with 0.1-0.5 mM IPTG

    • Post-induction growth at lower temperature (16-25°C) for 12-18 hours to enhance proper folding

For membrane proteins like nuoK, specialized approaches might be necessary:

  • Consider using E. coli C43(DE3) or C41(DE3) strains specifically designed for membrane protein expression

  • Inclusion of mild detergents (0.1-0.5% Triton X-100 or n-dodecyl-β-D-maltoside) during cell lysis can improve solubilization

What purification strategy yields the highest purity and activity for recombinant nuoK?

A multi-step purification approach is recommended:

  • Membrane fraction isolation:

    • Cell disruption via sonication or pressure-based homogenization

    • Differential centrifugation to isolate membrane fractions

    • Solubilization of membrane proteins using appropriate detergents

  • Immobilized metal affinity chromatography (IMAC):

    • Use of Ni-NTA or similar resin for His-tagged protein capture

    • Implementation of stepwise imidazole gradient (20-300 mM) for elution

    • Inclusion of detergent in all purification buffers to maintain protein solubility

  • Size exclusion chromatography:

    • Final polishing step to separate oligomeric states and remove aggregates

    • Buffer optimization to maintain enzyme activity

Drawing from methods used for similar enzymes, careful monitoring of cofactor retention (likely FMN based on related NADH:quinone oxidoreductases) throughout purification is essential for maintaining enzymatic activity .

How can researchers assess the enzymatic activity of recombinant nuoK?

Although specific methods for nuoK subunit activity aren't detailed in the search results, the following approaches can be adapted from studies on related NADH:quinone oxidoreductases:

Spectrophotometric assays:

  • Monitor NADH oxidation by measuring absorbance decrease at 340 nm

  • Track reduction of electron acceptors such as:

    • 2,6-dichlorophenolindophenol (DCPIP) at 600 nm

    • Coenzyme Q1 at 275 nm

    • Ferricyanide at 420 nm

Standard reaction conditions:

  • 50 mM buffer (MOPS or phosphate) at pH 7.0-7.5

  • 100-200 μM NADH as electron donor

  • Various electron acceptors at appropriate concentrations

  • Temperature optimization between 30-37°C

Table 1: Potential Electron Acceptors for Activity Assays

Electron AcceptorWorking ConcentrationWavelength for MonitoringExpected Activity Range
DCPIP50-100 μM600 nmHigh
Coenzyme Q150-100 μM275 nmModerate to High
Potassium ferricyanide1 mM420 nmModerate
1,4-Benzoquinone100 μM290 nmVariable
Ubiquinone50-100 μM275 nmHigh

What structural analysis techniques are most informative for understanding nuoK properties?

For comprehensive structural characterization, multiple complementary approaches should be employed:

  • Circular Dichroism (CD) Spectroscopy:

    • Assessment of secondary structural elements

    • Thermal stability evaluation through temperature-dependent CD

    • Cofactor binding analysis

  • Limited Proteolysis combined with Mass Spectrometry:

    • Identification of flexible regions and domain organization

    • Mapping of protease-resistant core domains

  • Homology Modeling:

    • Based on structurally characterized NADH:quinone oxidoreductases

    • Prediction of membrane-spanning regions and potential interaction sites

  • Detergent Screening for Crystallization:

    • Systematic evaluation of detergent classes for protein stability

    • Optimization of detergent:protein ratios for crystallization trials

For membrane proteins like nuoK, cryogenic electron microscopy (cryo-EM) may be particularly valuable for structural determination, especially as part of the larger NADH:quinone oxidoreductase complex.

How does NADH-quinone oxidoreductase contribute to Burkholderia phytofirmans colonization and plant growth promotion?

NADH-quinone oxidoreductase likely plays crucial roles in the metabolic versatility and ecological competence of Burkholderia phytofirmans:

  • Energy metabolism during colonization:

    • Efficient energy production during the transition from rhizosphere to endophytic lifestyle

    • Adaptation to varying oxygen availability in different plant tissues

    • Support for cellular processes during migration from roots to aerial parts

  • Redox balance maintenance:

    • Management of NAD+/NADH ratios during plant interaction

    • Contributing to cellular redox homeostasis under stress conditions

    • Potentially supporting bacterial survival during plant defense responses

  • Metabolism in different plant microenvironments:

    • Adaptation to varying carbon and energy sources available in different plant tissues

    • Support for growth during colonization of xylem vessels and systemic spread

The nuoK subunit, as part of the proton-pumping apparatus, would contribute to energy conservation during electron transport, enhancing the bacterium's metabolic efficiency in diverse plant environments.

What genomic and transcriptomic approaches can reveal the regulation of nuoK expression in Burkholderia phytofirmans?

To understand nuoK regulation in Burkholderia phytofirmans, researchers should consider:

  • RNA-Seq analysis:

    • Compare expression profiles under different growth conditions (free-living vs. plant-associated)

    • Analyze transcriptional changes during different stages of plant colonization

    • Identify co-regulated genes that may function in related pathways

  • Promoter analysis:

    • Identify regulatory elements upstream of the nuoK gene

    • Use reporter gene fusions to monitor expression in different conditions

    • Characterize transcription factors that may regulate nuoK expression

  • Comparative genomics:

    • Analyze the genomic context of nuoK across related Burkholderia strains

    • Identify conserved regulatory elements that may control expression

    • Compare with other plant-associated bacteria to identify common regulatory features

  • Chromatin immunoprecipitation (ChIP-seq):

    • Identify proteins binding to the nuoK promoter region

    • Characterize the regulon that includes nuoK

    • Map the regulatory network controlling energy metabolism during plant colonization

How can site-directed mutagenesis be used to investigate critical residues in nuoK function?

Site-directed mutagenesis represents a powerful approach to dissect structure-function relationships in nuoK:

  • Target selection strategy:

    • Conserved residues identified through multiple sequence alignment

    • Predicted membrane-spanning residues that may participate in proton translocation

    • Residues at potential subunit interfaces within the NADH:quinone oxidoreductase complex

  • Mutagenesis approach:

    • Use overlap extension PCR or commercially available mutagenesis kits

    • Create alanine scanning mutations across predicted functional domains

    • Generate charge reversal mutations for residues involved in proton movement

  • Functional characterization:

    • Compare NADH oxidation rates between wild-type and mutant proteins

    • Measure proton translocation efficiency using pH-sensitive fluorescent dyes

    • Assess complex assembly through blue native PAGE analysis

  • In vivo relevance:

    • Complementation of nuoK knockout strains with mutant variants

    • Evaluation of bacterial fitness and plant colonization capabilities

    • Assessment of energy metabolism in mutant strains

What are the most effective approaches for studying protein-protein interactions involving nuoK within the NADH-quinone oxidoreductase complex?

To characterize the interactions of nuoK within the larger complex:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.