Recombinant Burkholderia phytofirmans Probable intracellular septation protein A (Bphyt_1922)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Expression System

  • Host: Escherichia coli

  • Form: Lyophilized powder in Tris/PBS buffer (pH 8.0) with 6% trehalose

Putative Role

  • Septation: The protein is annotated as a probable intracellular septation factor, suggesting involvement in bacterial cell division by facilitating septum formation .

  • Membrane Localization: Predicted inner membrane-spanning domains align with its role in coordinating cell wall synthesis .

Research Applications

  • Antibiotic Target Studies: Potential candidate for investigating bacterial cell division inhibitors .

  • Protein Interaction Mapping: Used in pull-down assays to identify binding partners in Burkholderia spp. .

Pathway and Functional Data

  • Cell envelope biogenesis

  • Stress response regulation

Functional Limitations

  • No direct experimental evidence (e.g., knockout studies) confirming its role in septation or stress adaptation exists in public literature .

  • Interactions with other proteins (e.g., divisome components) remain uncharacterized .

Future Directions

  • Structural Studies: Cryo-EM or X-ray crystallography to resolve 3D architecture.

  • Genetic Knockouts: Assess phenotypic changes in Bphyt_1922-deficient B. phytofirmans strains.

  • Plant-Microbe Interaction Screens: Explore its role in PsJN’s endophytic colonization or stress resilience .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing the order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can serve as a reference for your preparations.
Shelf Life
The shelf life of our proteins is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
yciB; Bphyt_1922; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-176
Protein Length
full length protein
Species
Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN) (Burkholderia phytofirmans)
Target Names
Bphyt_1922
Target Protein Sequence
MKFLFDLFPIILFFVAFKIWGIFTATAVAIVATLVQIAWVAFRHRKVDPMLWVSLGVVTV FGGATLVLHNDTFIKWKPTVLYWAFSVALIVSQLAFNKNLIEAMMGKQITLPHAIWGKLS VVWAIFFVLLGLVNLFVAYNYTTDQWVNFKLFGATGCLVVFIVGQSLWLSKYMKEE
Uniprot No.

Target Background

Function
Plays a role in cell envelope biogenesis, maintaining cell envelope integrity, and regulating membrane homeostasis.
Database Links
Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Burkholderia phytofirmans Probable intracellular septation protein A (Bphyt_1922)?

Bphyt_1922 is a probable intracellular septation protein A found in Paraburkholderia phytofirmans PsJN, a beneficial endophytic bacterium. Based on homology studies with similar proteins like those found in Shigella flexneri, ispA is likely involved in cell division processes and may contribute to the bacterium's ability to colonize plant tissues effectively. The recombinant version typically consists of 176 amino acids and is often produced with an N-terminal His-tag for purification purposes . The protein is predicted to be highly hydrophobic, similar to the ispA protein characterized in other bacterial species such as Shigella flexneri, which has been shown to be a small (21 kDa), very hydrophobic protein essential for proper bacterial septation during cell division .

How does the function of Bphyt_1922 relate to P. phytofirmans PsJN's plant-beneficial properties?

While direct evidence linking Bphyt_1922 to P. phytofirmans PsJN's plant-beneficial properties is limited in the available literature, we can draw parallels from related research. P. phytofirmans PsJN is known to establish rhizosphere and endophytic colonization in various plants, promoting growth and inducing resistance against stresses . The bacterium's ability to colonize plant tissues effectively and migrate from roots to aerial parts depends on proper cell division and motility . As an intracellular septation protein, Bphyt_1922 likely contributes to these processes by ensuring proper bacterial cell division during colonization and proliferation within plant tissues. In related bacteria, mutations in ispA have been shown to cause defects in cell division, leading to the formation of long filamentous bacteria lacking septa , which would significantly impair the bacterium's ability to proliferate and colonize plant tissues effectively.

What expression systems are commonly used for producing recombinant Bphyt_1922?

The most commonly reported expression system for recombinant Bphyt_1922 is Escherichia coli . This bacterial expression system offers several advantages for producing this protein:

  • Efficient expression of prokaryotic proteins

  • Well-established protocols for transformation and protein induction

  • Compatibility with His-tag purification systems

  • Cost-effectiveness for research-scale protein production

The recombinant protein is typically expressed with an N-terminal His-tag to facilitate purification using metal affinity chromatography . When expressing Bphyt_1922, researchers should consider that as a probable membrane-associated protein, it may require specialized conditions to maintain proper folding and solubility during expression and purification.

What methodological challenges might arise when studying Bphyt_1922 function and how can they be addressed?

Studying Bphyt_1922 presents several methodological challenges:

Challenge 1: Protein solubility and membrane association
Given that ispA proteins in related bacteria are highly hydrophobic , Bphyt_1922 likely presents solubility issues during expression and purification.

Methodological solution: Researchers should consider:

  • Using detergents (e.g., n-dodecyl-β-D-maltoside or CHAPS) during extraction and purification

  • Employing specialized expression systems designed for membrane proteins

  • Testing fusion partners that enhance solubility (e.g., MBP, SUMO) alongside the His-tag

  • Optimizing expression temperature (often lowered to 16-18°C) to improve proper folding

Challenge 2: Functional characterization in planta
Determining Bphyt_1922's precise role in P. phytofirmans PsJN's plant interactions requires sophisticated approaches.

Methodological solution: Researchers should consider:

  • Creating gene knockout or knockdown mutants using CRISPR-Cas9 or homologous recombination

  • Complementation studies using the cloned ispA gene to rescue mutant phenotypes

  • Microscopy techniques to visualize bacterial colonization and cell division within plant tissues

  • Comparative transcriptomics of wild-type and mutant strains during plant colonization

Challenge 3: Protein-protein interaction identification
Understanding Bphyt_1922's interaction partners is crucial for elucidating its function.

Methodological solution: Employ a multi-faceted approach including:

  • Bacterial two-hybrid screening

  • Co-immunoprecipitation followed by mass spectrometry

  • Proximity-dependent biotin identification (BioID)

  • Fluorescence resonance energy transfer (FRET) for in vivo interaction validation

How can researchers design experiments to investigate the role of Bphyt_1922 in P. phytofirmans PsJN colonization of plant tissues?

A comprehensive experimental approach would include:

1. Generation of mutant and complemented strains:

  • Create Bphyt_1922 deletion mutants using site-directed mutagenesis

  • Develop complemented strains expressing the wild-type gene

  • Engineer fluorescently tagged strains (e.g., GFP-labeled) for visualization

2. Colonization assessment protocol:

  • Surface-sterilize plant seeds and germinate under aseptic conditions

  • Inoculate seedlings with wild-type, mutant, and complemented strains

  • Sample plants at different time points (e.g., 3h, 24h, 72h, 1 week) after inoculation

  • Quantify bacterial populations in rhizosphere, root interior, and aerial tissues using serial dilution plating on selective media

  • Compare colonization efficiency between strains using statistical analysis

3. Microscopic examination:

  • Prepare thin sections of inoculated plant tissues

  • Conduct confocal microscopy of GFP-labeled strains to visualize colonization patterns

  • Perform transmission electron microscopy to examine bacterial morphology and septation

  • Analyze differences in cell division and morphology between wild-type and mutant strains within plant tissues

4. Molecular analysis:

  • Extract RNA from bacteria isolated from different plant compartments

  • Perform RT-qPCR to quantify expression of Bphyt_1922 and related genes during colonization

  • Conduct RNA-seq to identify differentially expressed genes in wild-type vs. mutant strains

This experimental design would generate comprehensive data on Bphyt_1922's role in plant colonization, similar to studies that have demonstrated P. phytofirmans PsJN colonizes grapevine rhizoplane immediately after inoculation, transmits to the root interior within 3 hours, and systemically migrates to aerial tissues .

What are the key considerations for experimental design when comparing Bphyt_1922 function across different bacterial species?

When comparing Bphyt_1922 function across different bacterial species, researchers should consider:

1. Phylogenetic analysis and homology assessment:

  • Conduct comprehensive sequence alignment of ispA homologs

  • Perform phylogenetic analysis to understand evolutionary relationships

  • Identify conserved domains and motifs that might indicate functional conservation

  • Generate a similarity matrix to quantify sequence conservation across species:

SpeciesSequence Identity to Bphyt_1922 (%)Conserved MotifsPredicted Structure Similarity
P. phytofirmans PsJN100AllHigh
Shigella flexneri[Calculated value][Identified motifs][Prediction]
E. coli[Calculated value][Identified motifs][Prediction]
[Other species][Calculated value][Identified motifs][Prediction]

2. Complementation studies:

  • Clone ispA homologs from different species into expression vectors

  • Transform these constructs into ispA mutants of P. phytofirmans

  • Assess the ability of each homolog to restore wild-type phenotypes

  • Quantify complementation efficiency through measurements of:

    • Growth rates

    • Cell morphology

    • Plant colonization ability

    • Stress tolerance

3. Structural biology approaches:

  • Express and purify recombinant ispA proteins from multiple species

  • Determine protein structures using X-ray crystallography or cryo-EM

  • Compare structural features to identify conserved functional elements

  • Conduct molecular dynamics simulations to predict protein behavior

4. Functional context analysis:

  • Compare genomic neighborhoods of ispA genes across species

  • Identify co-occurring genes that might indicate functional relationships

  • Analyze transcriptomic data to compare expression patterns under similar conditions

  • Consider the ecological niches of each species when interpreting functional differences

This comparative approach would help distinguish between species-specific and conserved functions of ispA, providing insights into how this protein has evolved in different bacterial lineages.

What is the recommended protocol for purifying recombinant His-tagged Bphyt_1922?

Given the likely hydrophobic nature of Bphyt_1922 based on homology to other ispA proteins , a specialized purification protocol is recommended:

Materials:

  • IMAC column (e.g., Ni-NTA resin)

  • Lysis buffer: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole, 1% n-dodecyl-β-D-maltoside, protease inhibitors

  • Wash buffer: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 20 mM imidazole, 0.1% n-dodecyl-β-D-maltoside

  • Elution buffer: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 250 mM imidazole, 0.05% n-dodecyl-β-D-maltoside

  • Size exclusion chromatography buffer: 20 mM Tris-HCl pH 7.5, 150 mM NaCl, 0.03% n-dodecyl-β-D-maltoside

Procedure:

  • Express recombinant Bphyt_1922 in E. coli at reduced temperature (18°C) after induction

  • Harvest cells and resuspend in lysis buffer (10 mL per gram of wet cell weight)

  • Disrupt cells using sonication or high-pressure homogenization

  • Centrifuge at 20,000 × g for 30 minutes to remove cell debris

  • Collect the supernatant and apply to a pre-equilibrated Ni-NTA column

  • Wash with 10 column volumes of wash buffer

  • Elute protein with elution buffer, collecting 1 mL fractions

  • Analyze fractions by SDS-PAGE and pool protein-containing fractions

  • Further purify by size exclusion chromatography

  • Concentrate purified protein using a centrifugal concentrator with appropriate molecular weight cutoff

Critical steps and troubleshooting:

  • Maintaining detergent throughout purification is essential for protein stability

  • If protein precipitation occurs, consider screening different detergents

  • For functional studies, consider detergent exchange to more physiologically relevant alternatives

  • Verify protein identity by mass spectrometry or Western blotting

How can researchers effectively design gene knockout experiments to study Bphyt_1922 function in P. phytofirmans PsJN?

An effective gene knockout strategy for studying Bphyt_1922 function would involve:

1. Knockout construct design:

  • Amplify 500-1000 bp upstream and downstream regions flanking Bphyt_1922

  • Clone these fragments into a suicide vector with a selectable marker (e.g., kanamycin resistance)

  • Include counter-selection markers (e.g., sacB) to facilitate selection of double crossover events

  • Design PCR verification primers that span the deletion junction

2. Transformation and selection:

  • Introduce the knockout construct into P. phytofirmans PsJN via electroporation or conjugation

  • Select for single crossover events using appropriate antibiotics

  • Counter-select for double crossover events using sucrose sensitivity (with sacB)

  • Verify gene deletion by PCR and sequencing

  • Confirm absence of Bphyt_1922 expression by RT-PCR and Western blotting

3. Complementation strategy:

  • Clone the wild-type Bphyt_1922 gene with its native promoter into a broad-host-range plasmid

  • Transform the complementation construct into the knockout strain

  • Select transformants using an additional antibiotic marker

  • Verify expression of the complemented gene by RT-PCR

4. Phenotypic characterization:

  • Compare growth rates of wild-type, knockout, and complemented strains

  • Examine cell morphology using phase contrast and electron microscopy

  • Assess plant colonization ability using the methods described in section 2.2

  • Evaluate stress responses and other physiological parameters

This approach would provide robust evidence for Bphyt_1922's specific functions, similar to studies that have examined the roles of other genes in P. phytofirmans PsJN's plant interactions .

How should researchers interpret contradictory results between in vitro and in planta studies of Bphyt_1922?

When facing contradictory results between in vitro and in planta studies of Bphyt_1922, researchers should consider:

1. Systematic comparison approach:

  • Document all contradictions in a structured format

  • Analyze experimental conditions for both systems thoroughly

  • Consider the following comparison matrix:

AspectIn Vitro ObservationsIn Planta ObservationsPotential Explanations
Protein localization[Observation][Observation][Explanation]
Enzymatic activity[Observation][Observation][Explanation]
Interaction partners[Observation][Observation][Explanation]
Expression levels[Observation][Observation][Explanation]

2. Plant-specific factors to consider:

  • Plant defense responses may modify protein function or stability

  • Microenvironmental conditions (pH, ion concentrations) differ in plant tissues

  • Plant-derived signals might induce conformational changes or post-translational modifications

  • Expression of Bphyt_1922 might be regulated differently in planta

3. Technical considerations:

  • Confirm antibody specificity in both systems

  • Validate detection methods independently

  • Consider limitations of protein extraction from plant tissues

  • Assess whether bacterial gene expression systems accurately reflect in planta expression

4. Biological context interpretation:

  • Consider that contradictions may reflect true biological differences in protein function

  • Evaluate whether Bphyt_1922 might have multiple functions depending on context

  • Examine whether the protein functions as part of different complexes in different environments

  • Assess whether P. phytofirmans PsJN's endophytic lifestyle might trigger alternative protein functions

This systematic approach helps researchers distinguish between technical artifacts and genuine biological phenomena, similar to how researchers must interpret the complex colonization patterns observed when P. phytofirmans PsJN interacts with different plant species .

What statistical approaches are most appropriate for analyzing Bphyt_1922 mutant phenotypes in plant colonization experiments?

When analyzing Bphyt_1922 mutant phenotypes in plant colonization experiments, the following statistical approaches are recommended:

1. Bacterial enumeration data analysis:

  • Transform CFU/g data using log10 transformation to normalize distributions

  • Apply repeated measures ANOVA when comparing colonization across time points

  • Use nested ANOVA when analyzing colonization in different plant tissues

  • Include appropriate post-hoc tests (e.g., Tukey's HSD) for multiple comparisons

  • Calculate effect sizes (e.g., Cohen's d) to quantify the magnitude of differences

2. Microscopy data quantification:

  • Develop standardized scoring systems for colonization patterns

  • Use blind scoring to prevent observer bias

  • Apply non-parametric tests (e.g., Mann-Whitney U) for scored categorical data

  • Employ image analysis software to quantify bacterial distribution objectively

  • Calculate inter-observer reliability metrics when multiple researchers score samples

3. Advanced experimental designs:

  • Consider split-plot designs when testing multiple plant genotypes and bacterial strains

  • Use linear mixed-effects models to account for random effects (e.g., plant-to-plant variation)

  • Apply multivariate approaches (e.g., MANOVA) when measuring multiple response variables

  • Consider Bayesian statistical frameworks for complex experimental designs

  • Perform power analysis to determine appropriate sample sizes

4. Longitudinal data analysis:

  • Apply growth curve analysis for temporal colonization data

  • Use area-under-the-curve calculations to compare colonization efficiency

  • Consider time-series analysis for complex temporal patterns

  • Apply generalized estimating equations for correlated longitudinal data

These statistical approaches ensure robust analysis of the complex data generated when studying bacterial mutants in plant systems, similar to approaches used in studies of P. phytofirmans PsJN colonization dynamics .

What are the most promising approaches for uncovering the molecular mechanism of Bphyt_1922 function in bacterial cell division?

Based on current knowledge of intracellular septation proteins and P. phytofirmans biology, the following approaches hold significant promise:

1. Structural biology combined with mutagenesis:

  • Determine the high-resolution structure of Bphyt_1922 using X-ray crystallography or cryo-EM

  • Perform systematic alanine scanning mutagenesis to identify critical functional residues

  • Develop fluorescent protein fusions to track Bphyt_1922 localization during cell division

  • Use super-resolution microscopy to visualize co-localization with other division proteins

2. Interaction network mapping:

  • Conduct comprehensive protein-protein interaction screens using bacterial two-hybrid systems

  • Perform co-immunoprecipitation followed by mass spectrometry to identify interaction partners

  • Apply chromatin immunoprecipitation (ChIP) if Bphyt_1922 has any DNA-binding properties

  • Develop an interactome map comparing wild-type and mutant strains

3. In situ approaches:

  • Develop tools for studying Bphyt_1922 function directly within plant tissues

  • Apply correlative light and electron microscopy to visualize protein localization during colonization

  • Use FRET-based biosensors to detect potential enzymatic activities

  • Employ single-cell RNA-seq to examine expression heterogeneity during colonization

4. Comparative genomics and systems biology:

  • Analyze conservation of Bphyt_1922 across plant-associated bacteria

  • Identify co-evolving proteins that might function in the same pathway

  • Apply metabolomics to detect changes in bacterial metabolism when Bphyt_1922 is disrupted

  • Develop computational models predicting the impact of Bphyt_1922 on cell division dynamics

These approaches would build on existing knowledge of P. phytofirmans PsJN's genomic capabilities and known functions of ispA proteins in other bacteria , advancing our understanding of this protein's role in bacterial biology and plant-microbe interactions.

How might understanding Bphyt_1922 function contribute to engineering improved plant-growth promoting bacteria?

Understanding Bphyt_1922 function could contribute to engineering improved plant-growth promoting bacteria through several strategic applications:

1. Enhancing colonization efficiency:

  • If Bphyt_1922 is critical for proper cell division during plant colonization, optimizing its expression could enhance bacterial persistence in planta

  • Creating variant proteins with improved functionality might accelerate bacterial establishment in the rhizosphere

  • Engineering strains with regulated Bphyt_1922 expression could allow for controlled colonization patterns

  • Targeting Bphyt_1922 to specific cellular locations might improve certain aspects of the plant-microbe interaction

2. Cross-species functionality transfer:

3. Stress adaptation improvement:

  • Understanding how Bphyt_1922 contributes to bacterial survival under different plant-associated conditions could lead to strains with enhanced stress tolerance

  • Engineering Bphyt_1922 expression to respond to specific plant signals might improve symbiotic relationships

  • Optimizing cellular division under stress conditions could enhance bacterial persistence during environmental challenges

  • Creating conditional expression systems linked to plant health status could develop responsive beneficial microbes

4. Applied biotechnology opportunities:

  • Developing biosensors based on Bphyt_1922 function to monitor bacterial colonization in real-time

  • Creating diagnostic tools to assess plant-microbe interaction efficiency

  • Engineering consortia of bacteria with complementary Bphyt_1922 functions for enhanced plant benefits

  • Developing precision agriculture applications based on optimized bacterial colonization

These engineering approaches could significantly advance the application of P. phytofirmans PsJN and related bacteria in sustainable agriculture, building on their known plant growth-promoting and stress protection capabilities .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.