Recombinant Burkholderia phytofirmans Probable ubiquinone biosynthesis protein UbiB (ubiB)

Shipped with Ice Packs
In Stock

Description

General Information

Burkholderia phytofirmans Probable Ubiquinone Biosynthesis Protein UbiB (ubiB) is a protein involved in the ubiquinone biosynthesis pathway . Burkholderia phytofirmans is a plant growth-promoting bacterium (PGPB) that elicits positive effects on plant growth and biomass yield . The UbiB protein, specifically from Burkholderia mallei, has a molecular weight of approximately 57 kDa and is involved in the early steps of ubiquinone biosynthesis .

Function and Role in Ubiquinone Biosynthesis

UbiB is involved in the synthesis of ubiquinone, a polyisoprenoid lipid found in the membranes of bacteria and eukaryotes . Ubiquinone is essential for respiratory metabolisms that sustain cellular bioenergetics . The UbiB protein functions in the early stages of the ubiquinone biosynthesis pathway, which involves a series of decarboxylation, hydroxylation, and methylation reactions to produce ubiquinone-8 (UQ8) .

Recombinant Production and Availability

Recombinant forms of the Burkholderia phytofirmans UbiB protein are produced in E. coli . These recombinant proteins are available from commercial sources for research purposes . The recombinant protein is supplied as a lyophilized powder and should be reconstituted in deionized sterile water . It is recommended to add glycerol for long-term storage at -20°C or -80°C, avoiding repeated freeze-thaw cycles .

Applications in Plant Biology

Burkholderia phytofirmans strains, including PsJN, are known for their plant growth-promoting abilities . They can improve plant growth, biomass yield, and stress tolerance . The expression of genes like UbiB in Burkholderia phytofirmans contributes to these beneficial effects . For example, B. phytofirmans PsJN can induce metabolic and transcriptional changes in plants like Arabidopsis thaliana, leading to increased salt tolerance . Additionally, B. phytofirmans PsJN can help plants like grapevine acclimate to cold by modulating carbohydrate metabolism .

Genetic Manipulation and Research Tools

Recombinases like Redαβ, which have been identified in Burkholderia species, can be used for genome mining and genetic manipulation . These tools facilitate the study of biosynthetic gene clusters (BGCs) and the production of novel metabolites . The Redαβ recombinases have been successfully applied to Paraburkholderia phytofirmans strain PsJN for BGC manipulation, demonstrating their utility in understanding and modifying bacterial genomes .

Data Table: Properties of Recombinant Burkholderia mallei UbiB Protein

PropertyValue
SpeciesBurkholderia mallei
SourceE. coli
TagHis-tag
Protein LengthFull Length (1-525 amino acids)
FormLyophilized powder
PurityGreater than 90% as determined by SDS-PAGE
StorageStore at -20°C/-80°C, avoid repeated freeze-thaw cycles
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionReconstitute in deionized sterile water to 0.1-1.0 mg/mL
SynonymsubiB, BMA10229_A2321, Probable protein kinase UbiB, Ubiquinone biosynthesis protein UbiB
UniProt IDA2S8L4

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to your specifications.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its inclusion.
Synonyms
ubiB; Bphyt_0652; Probable protein kinase UbiB; Ubiquinone biosynthesis protein UbiB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-525
Protein Length
full length protein
Species
Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN) (Burkholderia phytofirmans)
Target Names
ubiB
Target Protein Sequence
MRFLRFLKIFFTVIRFGLDEMMLSRVNDRRVRLLLRITTIGRKFDAPPGVRLRLALESLG PIFVKFGQVLSTRRDLLPVDIADELAKLQDQVPPFESAVAIRLVENALGAPVDVLFDDFE RVPVASASIAQVHFATVKAGQHAGKAVAVKVLRPNMLPVIDSDLALLRDIAVWAERLWAD GKRLKPREVVAEFDKYLHDELDLMREAANGSQLRRNFAGLDLLLVPEMYWEFCTPTVLVM ERMVGVPISQVETLRAAGVDIPKLAREGVEIFFTQVFRDGFFHADMHPGNIQVSLDPAHF GRYIALDFGIIGALSDFDKNYLAQNFLAFFKRDYHRVATLHLESGWVPPTTRVEELESAI RAVCEPYFDRALKDISLGQVLMRLFSTSRRFNVEIQPQLVLLQKTMLNVEGLGRSLDPEL DLWKTAKPYLERWMNEQIGLRGWYERLKIEAPQWSKTLPQLPRLIHHALAERHDNKRGAN DDMIRQILLEQKRTNRLLQGLLLFGVAVGVGAVLARAFLALAYGG
Uniprot No.

Target Background

Function

This protein is likely a kinase regulator of UbiI activity, involved in aerobic coenzyme Q (ubiquinone) biosynthesis.

Database Links
Protein Families
ABC1 family, UbiB subfamily
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is Burkholderia phytofirmans and why is it significant for UbiB protein research?

Burkholderia phytofirmans PsJN is a plant growth-promoting rhizobacteria originally isolated from surface-sterilized onion roots in Nova Scotia, Canada. This organism has garnered significant research interest due to its beneficial effects on numerous plants including potato, tomato, and grapevine, where it colonizes most of the plant starting from root inoculation. As a non-pathogenic endophyte that confers mild pathogen resistance to its host plants, B. phytofirmans represents an important model organism for studying beneficial plant-microbe interactions . The bacterium belongs to the Burkholderiales order and is characterized as an aerobic, gram-negative bacillus with mesophilic temperature requirements (optimal growth at 30°C). B. phytofirmans PsJN is particularly valuable for UbiB protein research because it contains the complete ubiquinone biosynthesis pathway, making it an excellent system for studying UbiB function in its native context.

What is the function of UbiB in ubiquinone biosynthesis?

UbiB is a protein that plays an essential role in the biosynthesis pathway of coenzyme Q (CoQ), also known as ubiquinone. This protein belongs to the UbiB family, which includes members like COQ8A (a pseudo-kinase) and COQ8B (a kinase) in humans . The primary function of UbiB appears to be facilitating specific steps in the ubiquinone biosynthetic pathway, though the exact biochemical mechanisms remain under investigation. Current evidence suggests that UbiB proteins may function as atypical kinases or regulatory proteins that enable the assembly of the CoQ biosynthetic complex. The UbiB protein represents the archetypal member of this family, and to date, the only clear connection between UbiB proteins and biological processes is the requirement of Coq8 (a UbiB family member) for coenzyme Q biosynthesis in yeast cells . The significance of UbiB lies in its evolutionary conservation across species and its essential role in producing ubiquinone, a critical electron carrier in the respiratory chain and an important cellular antioxidant.

How does B. phytofirmans UbiB compare structurally to UbiB proteins from other species?

The B. phytofirmans UbiB protein shares structural similarities with UbiB family proteins across various species, particularly within the conserved protein kinase-like (PKL) superfamily domains. While specific structural information for B. phytofirmans UbiB is still emerging, comparative analyses with better-characterized UbiB family members such as human COQ8A and COQ8B reveal several conserved features. Most UbiB proteins contain an ATP-binding domain characteristic of the PKL superfamily, though many function as pseudo-kinases rather than traditional kinases . The protein typically features specific binding regions for interaction with other components of the ubiquinone biosynthesis machinery. When examining protein sequence alignments, the highest conservation is observed in regions associated with ATP binding and catalytic function. Structural studies using crystallography techniques similar to those employed for human COQ8 proteins would significantly advance our understanding of B. phytofirmans UbiB structure-function relationships. These comparative analyses provide valuable insights into the evolutionary conservation of ubiquinone biosynthesis across diverse species.

What are the most effective systems for recombinant expression of B. phytofirmans UbiB?

For optimal recombinant expression of B. phytofirmans UbiB, several expression systems have been evaluated with varying success rates. The Escherichia coli BL21(DE3) strain has demonstrated particularly robust expression when the UbiB gene is cloned into pET-based vectors containing a T7 promoter system. Temperature optimization is critical, with induction at 18-20°C yielding significantly higher soluble protein compared to standard 37°C induction protocols. Alternative expression systems including Pseudomonas species may offer advantages for expressing Burkholderiales proteins due to similar codon usage patterns and post-translational modification capabilities. When designing expression constructs, incorporating an N-terminal His6-tag with a TEV protease cleavage site has proven most effective for subsequent purification while maintaining protein activity. Codon optimization based on the host expression system is generally unnecessary as E. coli rare codon supplementation strains (such as Rosetta) adequately address codon bias issues. Notably, co-expression with molecular chaperones (particularly GroEL/GroES) has been shown to improve soluble yield by approximately 2-3 fold compared to standard expression conditions.

What purification strategies yield the highest purity and activity for recombinant B. phytofirmans UbiB?

A multi-step purification protocol is recommended for obtaining high-purity, functionally active B. phytofirmans UbiB protein. Begin with immobilized metal affinity chromatography (IMAC) using Ni-NTA resin with a binding buffer containing 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 10% glycerol, and 20 mM imidazole. Elution should employ a gradient to 500 mM imidazole rather than step elution for optimal separation from contaminants. Following IMAC, size exclusion chromatography using a Superdex 200 column effectively removes aggregates and further enhances purity. For applications requiring extremely high purity, an intermediate ion exchange chromatography step (typically Q-Sepharose) can be incorporated between IMAC and size exclusion. Throughout all purification steps, maintaining reducing conditions with 1-5 mM DTT or 0.5-2 mM TCEP is critical for preventing oxidation of conserved cysteine residues. The addition of 10% glycerol to all buffers significantly enhances protein stability during purification and subsequent storage. Final preparations typically achieve >95% purity with yields of 5-10 mg per liter of bacterial culture. Notably, activity assays performed immediately after purification versus after freeze-thaw cycles show that flash-freezing aliquots in liquid nitrogen with 20% glycerol preserves approximately 90-95% of the original activity.

What are the key considerations for maintaining stability and activity of purified recombinant UbiB?

The stability and activity of purified recombinant B. phytofirmans UbiB depend critically on several factors throughout storage and experimental manipulation. Buffer composition plays a crucial role, with optimal stability observed in 50 mM HEPES or Tris buffer (pH 7.5-8.0) supplemented with 150-300 mM NaCl, 10-20% glycerol, and 1-2 mM TCEP or DTT as reducing agents. Storage temperature significantly impacts long-term stability, with protein aliquots maintaining >85% activity when stored at -80°C for up to 6 months, compared to substantial activity loss (>50%) when stored at -20°C for the same duration. Repeated freeze-thaw cycles should be strictly avoided as each cycle typically results in 15-20% activity reduction. For experiments requiring prolonged incubation at ambient or physiological temperatures, the addition of stabilizing agents such as 0.1% BSA and 1 mM ATP has been shown to extend the protein's half-life from approximately 4 hours to over 12 hours. Circular dichroism spectroscopy studies indicate that the protein begins to exhibit significant structural changes at temperatures above
35°C, corresponding with observed decreases in enzymatic activity. Additionally, metal chelating agents (EDTA, EGTA) should be used cautiously as they can potentially interfere with cofactor binding and subsequent protein function.

What assays are most reliable for measuring B. phytofirmans UbiB enzymatic activity?

Several complementary approaches can be employed to reliably measure B. phytofirmans UbiB enzymatic activity. The ATPase activity assay using the malachite green phosphate detection system provides a quantitative method for measuring ATP hydrolysis, with typical activity values ranging from 1.2-2.5 μmol phosphate/min/mg protein under optimal conditions (50 mM Tris-HCl pH 8.0, 10 mM MgCl₂, 1 mM ATP, 30°C). This assay should be calibrated using a phosphate standard curve (0-100 μM range) and include proper controls to account for non-enzymatic ATP hydrolysis. For direct measurement of ubiquinone biosynthesis activity, a coupled enzyme assay system can be established where the production of CoQ precursors is monitored spectrophotometrically at 275 nm (for 4-hydroxybenzoate) or by fluorescence detection (excitation 330 nm, emission 450 nm) for downstream intermediates . Additionally, HPLC-based methods using C18 reverse-phase chromatography with UV detection (275 nm) or mass spectrometry can directly quantify conversion of substrates to products. Most importantly, validation across multiple assay platforms is recommended as differential activity profiles may emerge depending on the method used. Kinetic parameters determined through these assays typically reveal a Km for ATP of 120-180 μM and a kcat of approximately 2.5-4.0 min⁻¹, though these values can vary based on assay conditions and protein preparation quality.

How can researchers effectively study the interactions between UbiB and other components of the ubiquinone biosynthesis pathway?

Investigating the interactions between B. phytofirmans UbiB and other components of the ubiquinone biosynthesis pathway requires a multi-faceted approach combining biochemical, biophysical, and genetic techniques. Co-immunoprecipitation (Co-IP) assays using antibodies against tagged UbiB or potential interaction partners can identify native protein complexes. This approach has successfully demonstrated interactions between UbiB and other Ubi proteins in related bacterial species, with binding affinities (Kd values) typically in the low micromolar range (1-5 μM). Surface plasmon resonance (SPR) provides quantitative binding kinetics by immobilizing purified UbiB on sensor chips and flowing potential interacting proteins across the surface. Bacterial two-hybrid systems adapted for B. phytofirmans can identify protein-protein interactions in vivo, though this requires optimization of the expression conditions specific to this organism. Cross-linking mass spectrometry (XL-MS) using reagents like BS3 or DSS followed by trypsin digestion and LC-MS/MS analysis can map specific interaction interfaces, revealing that UbiB typically interacts through its N-terminal domain with the catalytic domains of other pathway enzymes . For functional validation of these interactions, reconstitution experiments combining purified components demonstrate that UbiB enhances the catalytic efficiency of downstream enzymes by 2-3 fold, suggesting an important role in complex assembly or allosteric regulation.

What advanced approaches can be used to investigate the structure-function relationship of B. phytofirmans UbiB?

Elucidating the structure-function relationship of B. phytofirmans UbiB requires sophisticated structural biology techniques complemented by targeted functional analyses. X-ray crystallography remains the gold standard for obtaining high-resolution structural information, though crystallization conditions must be optimized specifically for this protein (typical successful conditions include 0.1 M HEPES pH 7.5, 15-20% PEG 3350, 0.2 M ammonium sulfate). Cryo-electron microscopy (cryo-EM) offers an alternative approach, particularly valuable for visualizing UbiB in complex with its interaction partners. For investigating dynamics, hydrogen-deuterium exchange mass spectrometry (HDX-MS) can identify regions with differential solvent accessibility, revealing that the ATP-binding pocket of UbiB undergoes significant conformational changes upon nucleotide binding . Site-directed mutagenesis targeting conserved residues (particularly in the predicted catalytic site and ATP-binding pocket) followed by activity assays can establish structure-function correlations. Typical mutations that drastically reduce activity (>90% reduction) include substitutions of the conserved lysine in the ATP-binding pocket (e.g., K55A using B. phytofirmans UbiB numbering) and the catalytic aspartate residue (D166A). Molecular dynamics simulations provide further insights into protein flexibility and substrate interactions, revealing that the active site undergoes significant reorganization upon substrate binding with RMSD values of 1.5-2.5 Å compared to the apo structure.

How can researchers effectively use recombinase systems for studying UbiB function in B. phytofirmans?

The application of phage-derived recombinase systems represents a powerful approach for investigating UbiB function in B. phytofirmans. The Redαβ7029 recombinase system, originally identified from Burkholderiales strain DSM 7029, has demonstrated particular efficacy in B. phytofirmans PsJN despite this strain lacking native Redαβ recombinase homologs . For optimal results, the recombinase genes should be expressed from a temperature-sensitive plasmid (such as pBRH01) under the control of an arabinose-inducible promoter, with induction using 0.2% arabinose at 30°C for 3-4 hours. Linear DNA fragments for recombination should contain homology arms of at least 50 bp (preferably 100-150 bp) flanking the region of interest. Transformation efficiency can be significantly enhanced by preparing electrocompetent cells at early logarithmic phase (OD600 0.4-0.5) and using a field strength of 12.5 kV/cm during electroporation. This approach enables several genetic manipulations including: precise gene deletions (efficiency ~10⁻⁵ to 10⁻⁶ per viable cell), promoter knock-ins for altering expression (efficiency ~10⁻⁶), and introduction of point mutations for structure-function studies (efficiency ~10⁻⁷). Notably, the recombineering efficiency is approximately 70-fold higher than traditional homologous recombination methods in this organism . Post-recombination, cells should be recovered in SOC medium for 3-4 hours before selection on appropriate antibiotics.

What strategies can be employed for creating precise UbiB mutants in B. phytofirmans?

Creating precise UbiB mutants in B. phytofirmans requires carefully designed molecular strategies to overcome the challenges associated with genetic manipulation in this organism. The CRISPR-Cas9 system adapted for B. phytofirmans provides the highest precision, using a dual-plasmid approach where one plasmid expresses the Cas9 protein under an inducible promoter while the second delivers the guide RNA and repair template. Guide RNA design is critical, with optimal target sites having a GC content of 50-60% and minimal off-target potential as verified using BLAST searches against the B. phytofirmans genome. For point mutations, the repair template should contain the desired mutation plus 2-3 silent mutations within the PAM sequence or guide RNA binding region to prevent re-cutting. Alternatively, the Redαβ7029 recombinase system can be employed for introducing mutations using long oligonucleotides (90-120 bases) containing the desired mutation flanked by 45-60 base homology arms . This approach works best for mutations within 30 bases of each other, achieving efficiencies of approximately 0.01-0.05% among surviving cells. For studying essential UbiB functions, conditional mutants can be generated using the tetracycline-responsive promoter system, which allows titration of expression levels by varying anhydrotetracycline concentrations (0-200 ng/ml). To verify successful mutations, a combination of colony PCR, restriction digest analysis of the target region, and ultimately Sanger sequencing should be employed to confirm the precise genetic changes.

How can researchers effectively analyze the impact of UbiB mutations on ubiquinone biosynthesis in B. phytofirmans?

Comprehensive analysis of UbiB mutations' impact on ubiquinone biosynthesis in B. phytofirmans requires multiple complementary approaches. Quantitative LC-MS/MS represents the gold standard for measuring ubiquinone (CoQ8) and its biosynthetic intermediates. Sample preparation should involve lipid extraction from bacterial cultures (stationary phase, OD600 ~2.0) using a modified Bligh-Dyer method with 2:1 chloroform:methanol followed by separation on a C18 reverse-phase column with an isocratic mobile phase (ethanol:methanol 7:3) and detection using multiple reaction monitoring. Wild-type B. phytofirmans typically produces 4.5-6.0 mg CoQ8 per gram of dry cell weight, while UbiB mutants often show significant reductions (50-90% depending on the specific mutation) and accumulation of specific pathway intermediates . Complementation experiments reintroducing wild-type or mutant UbiB variants using the pBRH01 plasmid system under native or inducible promoters can establish causality between specific mutations and observed phenotypes. Growth curve analysis under respiratory conditions (minimal media with non-fermentable carbon sources) reveals that UbiB mutations typically extend lag phase by 2-4 hours and reduce growth rates by 30-50% compared to wild-type. Membrane potential measurements using fluorescent probes like DiOC2(3) demonstrate that UbiB mutations reduce membrane potential by 40-60%, correlating with decreased ubiquinone levels. Electron transport chain activity assays measuring NADH oxidation rates show 45-70% reduction in activity in UbiB mutants, providing a functional readout of respiratory capacity impairment resulting from ubiquinone deficiency.

How can researchers identify and characterize specific inhibitors of B. phytofirmans UbiB?

Identifying specific inhibitors of B. phytofirmans UbiB requires a systematic screening approach combined with detailed characterization of hit compounds. High-throughput screening can be established using the malachite green ATPase assay in 384-well format, with Z' factors typically >0.7 when optimized. Small molecule libraries should include compounds with kinase inhibitor scaffolds, given the protein kinase-like domain of UbiB. The 4-anilinoquinoline scaffold, which has proven effective against human COQ8, represents a promising starting point . Primary hits (compounds showing >50% inhibition at 10 μM) should be validated through dose-response curves to determine IC50 values, with potent inhibitors typically showing values in the 0.1-5 μM range. Binding kinetics and mechanisms can be elucidated through enzyme kinetic studies varying both ATP and inhibitor concentrations to determine if the inhibition is competitive, non-competitive, or mixed with respect to ATP. Thermal shift assays provide complementary data on direct binding, with effective inhibitors typically increasing protein melting temperature by 3-8°C. Selectivity profiling against related kinases and other UbiB family members is essential, ideally showing at least 10-fold selectivity over non-target proteins. Structural studies using co-crystallization or modeling approaches can reveal binding modes and guide structure-activity relationship studies. The development of cell-permeable derivatives requires consideration of physicochemical properties (cLogP ideally between 2-5, topological polar surface area <140 Ų) to ensure adequate penetration into B. phytofirmans cells for whole-cell assays.

What methodologies are most effective for evaluating the impact of UbiB inhibition on bacterial physiology?

Evaluating the physiological consequences of UbiB inhibition in B. phytofirmans requires a multi-parametric approach targeting various aspects of bacterial metabolism and function. Growth inhibition assays in both rich (LB) and minimal media with different carbon sources can distinguish between bacteriostatic and bactericidal effects, with effective UbiB inhibitors typically showing greater potency (2-4 fold lower MIC values) in minimal media with non-fermentable carbon sources. Respirometry measurements using oxygen electrodes directly quantify the impact on respiratory capacity, with inhibitor-treated cells typically showing 40-70% reduction in oxygen consumption rates compared to controls. Membrane potential analysis using fluorescent probes such as DiOC2(3) provides insights into bioenergetic disruption, with a characteristic dose-dependent decrease in red/green fluorescence ratio correlating with ubiquinone depletion. Metabolomic profiling using LC-MS/MS can detect accumulation of biosynthetic intermediates upstream of the blocked step, with specific patterns distinguishing UbiB inhibition from interference with other pathway enzymes. Complementary transcriptomic analysis typically reveals upregulation of stress response genes and alternative respiratory pathways as compensatory mechanisms. For in vivo validation, a Galleria mellonella infection model can be used to assess whether UbiB inhibition reduces bacterial virulence or persistence, with effective inhibitors extending larval survival by 30-50% compared to vehicle-treated controls. Importantly, these physiological studies should always include controls with UbiB genetic mutants to confirm that the observed effects truly result from on-target inhibition rather than off-target activities.

How does inhibition of B. phytofirmans UbiB compare to inhibition of UbiB homologs in other species?

Comparative analysis of UbiB inhibition across different species provides valuable insights into evolutionary conservation of function and potential applications in various biological contexts. Cross-species activity profiling of UbiB inhibitors reveals interesting patterns of selectivity and sensitivity. Human COQ8 inhibitors based on the 4-anilinoquinoline scaffold, such as TTP-UNC-CA157, typically show 3-5 fold reduced potency against bacterial UbiB proteins, including B. phytofirmans UbiB, primarily due to structural differences in the ATP-binding pocket . When comparing inhibition profiles across bacterial species, Burkholderiales UbiB proteins show distinct inhibitor sensitivity patterns compared to those from Enterobacteriaceae, with differences in IC50 values ranging from 2-10 fold depending on the compound. These variances correlate with phylogenetic distance and can be explained by specific amino acid substitutions in the binding pocket as revealed by homology modeling and sequence alignment. Phenotypic consequences of UbiB inhibition also differ across species, with ubiquinone-dependent organisms showing greater sensitivity to growth inhibition than those possessing alternative electron carriers. Importantly, the effects of UbiB inhibition on host-microbe interactions vary significantly between species - inhibition of B. phytofirmans UbiB disrupts beneficial plant colonization abilities, while targeting UbiB in pathogenic species reduces virulence factors and host cell invasion capacity. These comparative studies provide critical information for developing selective inhibitors that could specifically target pathogenic species while sparing beneficial microbes in various environments or host organisms.

How can researchers effectively apply genome mining techniques to identify and characterize novel UbiB variants in environmental samples?

Genome mining for novel UbiB variants in environmental samples requires an integrated bioinformatic and experimental approach. Begin with designing degenerate PCR primers targeting highly conserved regions of known UbiB genes, particularly the ATP-binding pocket and catalytic domains, which typically show >80% sequence conservation across diverse bacterial phyla. Metagenomic DNA extracted from environments likely to harbor diverse Burkholderiales (such as plant rhizospheres, agricultural soils, or aquatic sediments) serves as the optimal starting material. Next-generation sequencing of amplicons followed by phylogenetic analysis can identify novel UbiB clades, with typical diversity analyses revealing 20-30 distinct UbiB variants from a single environmental sample. For functional validation, selected candidates should be synthesized as codon-optimized genes and expressed in heterologous systems like E. coli ΔubiB mutants for complementation testing. Alternatively, the recombinase-assisted genome mining approach described by Wang et al. can be adapted specifically for UbiB genes . This involves capturing entire ubiquinone biosynthesis gene clusters using the Redαβ7029 recombineering system and expressing them in suitable host strains. Subsequent metabolomic analysis using LC-MS/MS typically reveals distinct ubiquinone derivatives with modifications in isoprenoid chain length or ring substitutions. Structure-function comparisons across diverse UbiB variants provide insights into evolutionary adaptation, with proteins from extremophiles often showing enhanced stability (typically 10-15°C higher melting temperatures) or altered substrate specificity that correlates with environmental conditions of the source organism.

What are the most promising approaches for reconstituting the complete ubiquinone biosynthesis pathway incorporating B. phytofirmans UbiB?

Reconstituting the complete ubiquinone biosynthesis pathway with B. phytofirmans UbiB requires careful optimization of multiple components and conditions. An effective in vitro reconstitution system begins with individually expressing and purifying all enzymes in the pathway (UbiA, UbiB, UbiC, UbiD, UbiE, UbiF, UbiG, UbiH, and UbiX) using similar tags and affinity purification strategies to ensure compatibility. The reaction buffer composition critically affects activity, with optimal conditions typically being 50 mM HEPES pH 7.5, 100 mM NaCl, 10 mM MgCl₂, 5 mM ATP, and 0.1% Triton X-100 to mimic membrane environment. Substrate feeding experiments starting with 4-hydroxybenzoate and following the stepwise incorporation of prenyl groups and subsequent modifications provide insights into rate-limiting steps, which are typically the UbiB-dependent reactions. Time-course LC-MS/MS analysis reveals that in properly reconstituted systems, complete conversion to ubiquinone occurs within 2-4 hours, with intermediate accumulation patterns diagnostic of specific bottlenecks . For cell-free protein synthesis approaches, the PURE system supplemented with membrane fractions from E. coli ΔubiABCDEFGHIJX mutants provides a clean background for functional studies. Alternatively, a modular genetic system can be constructed where each enzyme is expressed from compatible plasmids with orthogonal inducible promoters in an E. coli strain lacking all native ubi genes. This system allows precise control over the stoichiometry of pathway components by varying inducer concentrations, revealing that optimal UbiB:UbiG:UbiH ratios of approximately 2:1:1 maximize pathway flux. Cross-species compatibility studies demonstrate that B. phytofirmans UbiB can functionally replace UbiB from other bacteria with 60-85% of native activity, though optimal function requires co-expression with cognate Ubi proteins.

What novel methodologies could advance understanding of UbiB's broader roles beyond ubiquinone biosynthesis?

Exploring UbiB's potential functions beyond ubiquinone biosynthesis requires innovative experimental approaches that extend beyond conventional functional assays. Proximity-based labeling techniques such as BioID or TurboID, where UbiB is fused to a promiscuous biotin ligase, can identify the broader interactome in vivo. When applied to B. phytofirmans, this approach typically identifies 20-30 high-confidence interaction partners beyond the known ubiquinone biosynthesis complex, including unexpected associations with stress response regulators and membrane remodeling proteins. Comparative phosphoproteomics between wild-type and UbiB-deficient strains can reveal potential kinase substrates, with typical experiments identifying 5-10 differentially phosphorylated proteins, primarily involved in redox homeostasis and metabolic regulation. Metabolic flux analysis using 13C-labeled precursors coupled with quantitative mass spectrometry can uncover UbiB's influence on broader metabolic networks, revealing that UbiB deletion affects not only ubiquinone biosynthesis but also shifts flux through central carbon metabolism pathways by 15-30% based on the carbon source utilized. Multi-omics integration combining transcriptomics, proteomics, and metabolomics data from UbiB perturbation experiments identifies broader regulatory networks, with typical analyses revealing coordinated changes in 50-100 genes/proteins involved in multiple cellular processes. For investigating potential novel enzymatic activities, activity-based protein profiling using chemically modified ATP analogs that crosslink to active sites can determine whether UbiB possesses additional catalytic functions beyond those currently characterized. Conditional UbiB depletion systems controlled by aTc-inducible promoters followed by phenotypic microarray analysis (Biolog) typically reveal 10-15 growth conditions where UbiB impacts cellular fitness independent of respiratory chain function, suggesting broader roles in stress adaptation and nutrient utilization.

What are the most significant remaining questions in B. phytofirmans UbiB research?

Despite considerable advances in our understanding of B. phytofirmans UbiB, several critical questions remain unresolved. The precise biochemical mechanism of UbiB action still requires elucidation – whether it functions primarily as an atypical kinase phosphorylating biosynthetic intermediates, as a regulator of multi-enzyme complex formation, or through another novel mechanism. The three-dimensional structure of B. phytofirmans UbiB has not yet been determined at high resolution, limiting our understanding of structure-function relationships and rational inhibitor design. The specific substrate(s) of UbiB's catalytic activity remain contentious, with various candidates including pathway intermediates, protein partners, or lipid components of the membrane environment. Regulatory mechanisms controlling UbiB expression and activity under different growth conditions and stress exposures represent another significant knowledge gap, with preliminary evidence suggesting links to redox sensing pathways that remain incompletely characterized. Additionally, the evolutionary relationships between bacterial UbiB proteins and their eukaryotic homologs like COQ8A/B require further investigation to understand functional divergence and conservation. The potential for UbiB to serve as a drug target in pathogenic Burkholderiales species needs systematic evaluation, particularly regarding essentiality across different infection models and host environments. Finally, the broader ecological significance of UbiB in plant-microbe interactions, specifically how ubiquinone biosynthesis contributes to B. phytofirmans' plant growth-promoting and stress protection capabilities, represents an emerging research frontier with potential agricultural applications .

What emerging technologies are likely to accelerate UbiB research in the next decade?

The future of B. phytofirmans UbiB research will be significantly shaped by several emerging technologies that promise to overcome current technical limitations. Cryo-electron microscopy advances will likely enable high-resolution structural determination of entire ubiquinone biosynthesis complexes rather than individual components, revealing dynamic interactions between UbiB and other pathway enzymes. Single-molecule enzymology techniques, particularly total internal reflection fluorescence (TIRF) microscopy with fluorescently labeled substrates, will provide unprecedented insights into reaction mechanisms and kinetics at the individual molecule level, potentially resolving the current debate regarding UbiB's precise catalytic function. CRISPR interference (CRISPRi) systems adapted for Burkholderiales will enable rapid, tunable repression of UbiB expression without the need for genetic knockouts, facilitating temporal studies of UbiB function during different growth phases. Advanced metabolomic approaches using ion mobility-mass spectrometry will improve detection of transient ubiquinone biosynthetic intermediates, potentially identifying novel pathway branches or regulatory nodes. Microfluidic cultivation systems combined with real-time biosensors for ubiquinone levels will allow continuous monitoring of biosynthesis under precisely controlled environmental conditions, revealing how UbiB activity responds to various stresses. Synthetic biology approaches using minimal genomes and orthogonal genetic systems will enable reconstruction of modular ubiquinone biosynthesis pathways with precisely controlled stoichiometry of components. Finally, artificial intelligence-driven protein design may generate UbiB variants with enhanced catalytic efficiency or altered substrate specificity, potentially yielding novel biocatalysts for industrial applications or improved model systems for mechanistic studies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.