Recombinant Burkholderia phytofirmans Protease HtpX homolog (htpX)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it in your order. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is decided during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
htpX; Bphyt_0312; Protease HtpX homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-285
Protein Length
full length protein
Species
Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN) (Burkholderia phytofirmans)
Target Names
htpX
Target Protein Sequence
MFNWVKTAMLMAAITALFIVIGGMIGGSRGMTIALVIALGMNFFSYWFSDKMVLRMYNAQ EVDETSAPQFYRMVRELSTRAGLPMPRVYLINEDAPNAFATGRNPEHAAVAATTGILRVL SEREMRGVMAHELSHVKHRDILISTISATMAGAISALANFAMFFGSRDENGRSTNPIAGI AVALLAPIAGALIQMAISRAREFEADRGGAQISGDPQALASALDKIHRYASGIPFPTAEQ HPATAQMMIMNPLSGGGIANLFSTHPATEERIARLMEMARTGRFE
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Burkholderia phytofirmans Protease HtpX homolog and what is its significance in research?

Burkholderia phytofirmans Protease HtpX homolog (htpX) is a zinc metalloproteinase belonging to the M48 family. The full-length protein (285 amino acids) is encoded by the htpX gene (also known as Bphyt_0312) with UniProt ID B2T1K8. This protease is significant in research because it participates in membrane protein quality control mechanisms. HtpX proteases are integral membrane proteins containing transmembrane segments that enable them to identify and process misfolded or damaged membrane proteins. Understanding htpX function provides insights into bacterial stress response, protein quality control, and potentially antimicrobial resistance mechanisms .

How is recombinant Burkholderia phytofirmans Protease HtpX typically produced for research applications?

Recombinant Burkholderia phytofirmans Protease HtpX is typically produced using E. coli expression systems. The full-length protein (amino acids 1-285) is commonly fused to an N-terminal His-tag to facilitate purification. After expression, the protein is purified to greater than 90% purity as determined by SDS-PAGE and prepared as a lyophilized powder. For research applications, the protein can be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL, and 5-50% glycerol is recommended as a final concentration for long-term storage .

What are the optimal storage and handling conditions for recombinant Burkholderia phytofirmans Protease HtpX?

For optimal maintenance of activity, recombinant Burkholderia phytofirmans Protease HtpX should be stored at -20°C/-80°C upon receipt, with aliquoting necessary for multiple use to avoid repeated freeze-thaw cycles. Working aliquots can be stored at 4°C for up to one week. The protein is typically supplied in Tris/PBS-based buffer with 6% trehalose at pH 8.0. When reconstituting the lyophilized powder, it is recommended to briefly centrifuge the vial prior to opening to bring the contents to the bottom. For long-term storage, adding glycerol to a final concentration of 50% and storing at -20°C/-80°C is recommended .

What are the key structural features of HtpX proteases and how do they relate to function?

HtpX proteases are characterized by several key structural features that directly relate to their function:

  • Transmembrane domains: HtpX contains four hydrophobic regions (H1-H4) that can function as transmembrane segments, though whether the two C-terminal regions are membrane-embedded remains controversial.

  • Zinc-binding motif: As an M48 family metalloproteinase, HtpX contains a HEXXH motif that coordinates a zinc ion essential for its proteolytic activity.

  • Membrane orientation: The protease domains are positioned to access both membrane-embedded and cytoplasmic portions of substrate proteins.

This structural arrangement allows HtpX to participate in quality control of membrane proteins by recognizing and cleaving misfolded or damaged proteins within the membrane environment. The transmembrane segments likely help in substrate recognition while the zinc-dependent catalytic site executes the proteolytic function .

How does Burkholderia phytofirmans HtpX protease activity compare with HtpX homologs from other bacterial species?

Comparative analysis of HtpX homologs across bacterial species reveals both conserved and distinct functional characteristics:

SpeciesUniProt IDKey FeaturesFunction
Burkholderia phytofirmansB2T1K8285 aa, N-terminal His tagMembrane protein quality control, potential role in plant growth promotion
Escherichia coliP23894Well-characterized modelMembrane protein quality control, works with FtsH in protein degradation
Stenotrophomonas maltophiliaVariousUpregulated in response to kanamycinCritical for intrinsic aminoglycoside resistance
Herminiimonas arsenicoxydansA4G729293 aaPotentially involved in arsenic resistance mechanisms

While the core proteolytic mechanism appears conserved across species, functional adaptations are evident. For instance, in Stenotrophomonas maltophilia, HtpX plays a crucial role in aminoglycoside resistance, whereas in Burkholderia phytofirmans, it may have additional functions related to plant-microbe interactions. These functional differences likely reflect adaptations to specific ecological niches and environmental stressors .

What methods are available for measuring the proteolytic activity of HtpX in vitro and in vivo?

Several methodological approaches have been developed to measure HtpX proteolytic activity:

In vivo assays:

  • Model substrate-based assays: Researchers have constructed model substrates specifically for HtpX that allow for semiquantitative and convenient assessment of protease activity in living cells. These systems enable detection of differential protease activities among HtpX mutants carrying mutations in conserved regions.

In vitro assays:

  • Purified protein activity assays: Using synthetic peptides or purified proteins as substrates, followed by detection of cleavage products via SDS-PAGE, mass spectrometry, or fluorescence-based methods.

  • Zinc-dependent metalloprotease assays: Employing chelating agents as controls to demonstrate zinc dependence.

When designing activity assays, it's important to consider that physiological substrates of HtpX remain largely unidentified. The model substrate approach has proven particularly valuable as it enables functional assessment without requiring knowledge of all natural substrates .

How can researchers effectively manipulate HtpX expression and activity for functional studies?

For effective manipulation of HtpX expression and activity in functional studies, researchers can employ several strategic approaches:

Genetic approaches:

  • Gene deletion mutants: Creating in-frame deletions of htpX for loss-of-function studies. This has been successfully implemented in various bacterial species to investigate the role of HtpX in processes such as aminoglycoside resistance.

  • Complementation studies: Re-introducing wild-type or mutated versions of htpX into deletion mutants to verify phenotype rescue and study structure-function relationships.

  • Site-directed mutagenesis: Introducing specific mutations in conserved regions, particularly in the zinc-binding HEXXH motif, to investigate the importance of specific residues for proteolytic function.

Biochemical approaches:

  • Zinc chelators: Using EDTA or other zinc chelators to inhibit the metalloprotease activity.

  • Recombinant protein variants: Expressing and purifying variants with specific tags (His, Myc) to facilitate detection and activity studies.

These approaches should be complemented with appropriate activity assays as described in section 2.3 to determine the functional consequences of the manipulations .

What is the relationship between Burkholderia phytofirmans HtpX and plant growth promotion mechanisms?

The relationship between Burkholderia phytofirmans HtpX and plant growth promotion represents an intriguing research frontier:

Burkholderia phytofirmans is a well-established plant growth-promoting rhizobacterium (PGPR) that colonizes both the rhizosphere and internal plant tissues. Studies have shown that B. phytofirmans strain PsJN increases several growth parameters and accelerates plant growth rates in early ontogeny. Transcriptome analysis of Arabidopsis thaliana plants inoculated with B. phytofirmans revealed 408 genes with differential expression, many involved in stress response and hormone pathways, particularly auxin and gibberellin pathways .

While the direct role of HtpX in these plant growth-promoting effects hasn't been fully elucidated, several hypotheses can be proposed:

  • Membrane protein quality control in rhizosphere adaptation: HtpX may help B. phytofirmans maintain membrane integrity during colonization of plant tissues, indirectly supporting its plant growth-promoting activities.

  • Protein processing in signaling: HtpX might process bacterial proteins involved in plant-microbe signaling pathways.

  • Stress response regulation: As plants respond to bacterial colonization with various stress responses, bacterial HtpX might contribute to modulating these interactions.

Future research directions should include creating htpX deletion mutants in B. phytofirmans and evaluating their plant growth-promoting abilities compared to wild-type strains .

What role does HtpX play in bacterial stress response and antimicrobial resistance?

HtpX plays significant roles in bacterial stress response and antimicrobial resistance through several mechanisms:

  • Aminoglycoside resistance: In Stenotrophomonas maltophilia, studies have demonstrated that HtpX is upregulated in response to kanamycin exposure. Deletion of htpX significantly increased susceptibility to aminoglycosides (2- to 16-fold reduction in MICs), identifying it as a primary determinant of intrinsic aminoglycoside resistance. This phenotype was reversible when complemented with wild-type htpX .

  • Membrane protein quality control: As a membrane-localized proteolytic system, HtpX helps maintain membrane integrity by degrading misfolded or damaged membrane proteins that could otherwise compromise cellular function under stress conditions .

  • Synergistic protease networks: HtpX works in coordination with other proteases. Notably, double deletion mutants of clpA (a cytoplasmic protease) and htpX exhibited the most substantial decrease in aminoglycoside resistance, suggesting that these represent complementary systems addressing stress-induced protein damage in different cellular compartments .

The table below summarizes experimental findings on HtpX-mediated aminoglycoside resistance:

Bacterial StrainModificationEffect on Aminoglycoside MICsReversible with Complementation
S. maltophilia KJΔhtpX2- to 16-fold reductionYes
S. maltophilia KJΔclpAΔhtpXMost substantial decreasePartial

These findings position HtpX as a potential target for aminoglycoside adjuvant therapy to enhance antibiotic efficacy against resistant bacterial infections .

What are the critical factors to consider when designing experiments with recombinant HtpX?

When designing experiments with recombinant HtpX, researchers should consider several critical factors:

Protein stability and activity considerations:

  • Buffer composition: HtpX activity is zinc-dependent, so buffers should not contain chelating agents unless used as negative controls.

  • pH conditions: Optimal activity typically occurs between pH 7-8 in Tris-based buffers.

  • Detergents: As a membrane protein, HtpX may require mild detergents for solubility while maintaining native folding and activity.

  • Temperature: Storage at -20°C/-80°C for long-term, with working aliquots at 4°C for up to one week to avoid repeated freeze-thaw cycles.

Experimental design considerations:

  • Controls: Include both positive controls (known substrates if available) and negative controls (zinc chelation, heat-inactivated enzyme).

  • Substrate selection: When studying proteolytic activity, consider membrane-associated substrates or model substrates specifically designed for HtpX.

  • Detection methods: Plan for appropriate detection methods based on expected cleavage products and available tools (antibodies, fluorescent tags, etc.).

Expression system considerations:

  • For studying plant-microbe interactions, consider whether to use the native Burkholderia system or heterologous expression.

  • When using E. coli expression systems, codon optimization may improve yield .

How can researchers effectively troubleshoot common issues with HtpX activity assays?

Troubleshooting HtpX activity assays requires systematic approaches to address common issues:

Low or no detectable activity:

  • Verify protein integrity: Run SDS-PAGE to confirm protein hasn't degraded during storage or handling.

  • Check zinc availability: HtpX is a zinc-dependent metalloprotease; adding ZnCl₂ (1-5 μM) to reaction buffers may restore activity.

  • Assess substrate accessibility: For membrane-associated substrates, ensure proper membrane reconstitution or detergent conditions.

  • Optimize reaction conditions: Systematically vary pH (6.5-8.5), salt concentration, and temperature to identify optimal conditions.

High background or non-specific cleavage:

  • Include protease inhibitor controls: Use specific inhibitors to distinguish HtpX activity from contaminating proteases.

  • Purify protein further: Consider additional purification steps if contaminating proteases are suspected.

  • Optimize substrate:enzyme ratio: Excessive enzyme can lead to non-specific cleavage.

Inconsistent results between experiments:

  • Standardize protein storage conditions: Aliquot protein to avoid repeated freeze-thaw cycles.

  • Use internal controls: Include a standard substrate with known cleavage efficiency in each experiment.

  • Normalize activity calculations: Account for batch-to-batch variations in enzyme concentration or specific activity .

What are the latest methodological advances for studying HtpX interactions with membrane substrates?

Recent methodological advances have significantly enhanced our ability to study HtpX interactions with membrane substrates:

In vivo assay systems:
Researchers have developed an in vivo semiquantitative and convenient protease activity assay system for HtpX using model substrates. This system enables detection of differential protease activities among HtpX mutants with mutations in conserved regions, providing a powerful tool for structure-function studies .

Membrane protein reconstitution approaches:

  • Nanodiscs: Phospholipid bilayers surrounded by scaffold proteins providing a native-like membrane environment for both HtpX and its substrates.

  • Liposomes: Artificial vesicles incorporating both HtpX and potential substrates to study activity in a controlled membrane environment.

Advanced proteomic approaches:

  • SWATH-MS (Sequential Window Acquisition of all Theoretical Mass Spectra): For unbiased identification of HtpX substrates and cleavage sites.

  • Proximity labeling proteomics: To identify proteins in close proximity to HtpX in native membrane environments.

Structural biology advances:

  • Cryo-EM approaches optimized for membrane proteins to visualize HtpX structure and substrate interactions.

  • Hydrogen-deuterium exchange mass spectrometry to map dynamic interactions between HtpX and substrates.

These methodological advances offer researchers powerful new tools to unravel the precise mechanisms of HtpX function in membrane protein quality control and its broader roles in bacterial physiology and plant-microbe interactions .

What are the most promising research avenues for understanding HtpX function in plant-microbe interactions?

Several promising research avenues could advance our understanding of HtpX function in plant-microbe interactions:

  • Creation and characterization of B. phytofirmans htpX mutants: Developing htpX knockout strains and assessing their ability to colonize plants and promote growth compared to wild-type strains would directly link HtpX function to plant-microbe interactions.

  • Transcriptome analysis during plant colonization: Comparing gene expression profiles of wild-type and htpX mutant strains during different stages of plant colonization could reveal pathways influenced by HtpX activity.

  • Substrate identification in plant-associated contexts: Using proteomic approaches to identify HtpX substrates specifically during plant colonization might reveal proteins involved in adaptation to the plant environment.

  • HtpX-mediated response to plant defense compounds: Investigating whether HtpX plays a role in bacterial resistance to antimicrobial compounds produced by plants during colonization.

  • Comparative analysis across PGPR species: Examining HtpX conservation, expression, and function across different plant growth-promoting rhizobacteria could reveal convergent mechanisms of plant-microbe interaction .

How might HtpX be exploited as a target for developing novel antimicrobial strategies?

HtpX presents several promising avenues for exploitation as an antimicrobial target:

  • Aminoglycoside adjuvant therapy: Research has demonstrated that HtpX is a primary determinant of intrinsic aminoglycoside resistance in some bacteria. Specific inhibitors of HtpX could potentially serve as adjuvants to restore or enhance aminoglycoside efficacy against resistant strains. This approach is particularly promising as double mutants lacking both HtpX and ClpA showed the most substantial decrease in aminoglycoside resistance .

  • Membrane destabilization strategy: As HtpX participates in membrane protein quality control, its inhibition could lead to accumulation of misfolded membrane proteins, compromising membrane integrity and bacterial viability under stress conditions.

  • Structure-based inhibitor design: With advancing structural biology techniques, determining the structure of HtpX could enable rational design of specific inhibitors targeting its active site or regulatory domains.

  • Bacterial species selectivity: Exploiting structural or functional differences between HtpX homologs across bacterial species could enable development of species-selective antimicrobials with reduced impact on beneficial microbiota.

These approaches might be particularly valuable against bacterial species where HtpX plays critical roles in stress response and antibiotic resistance mechanisms .

What technological developments are needed to advance research on membrane proteases like HtpX?

Several technological developments could significantly advance research on membrane proteases like HtpX:

  • Improved membrane protein structural determination methods: Despite recent advances, determining structures of membrane proteases remains challenging. Enhanced cryo-EM techniques specifically optimized for membrane proteins and computational methods for modeling membrane protein-substrate interactions would accelerate mechanistic understanding.

  • In situ activity probes: Development of specific activity-based probes that can label active HtpX in living cells would allow tracking of protease activation under various conditions and localization within bacterial membranes.

  • High-throughput substrate identification systems: Technologies that allow rapid and systematic identification of physiological substrates of membrane proteases would address a fundamental knowledge gap in the field.

  • Controlled expression systems for toxic membrane proteins: Since overexpression of membrane proteases can be toxic to cells, developing tightly regulated expression systems would facilitate functional studies.

  • Single-molecule techniques for membrane proteins: Adapting single-molecule fluorescence or force spectroscopy for membrane proteases would provide insights into dynamics and mechanisms impossible to obtain through bulk measurements.

These technological advances would not only benefit HtpX research but would broadly impact the study of membrane proteases across biological systems .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.