Recombinant Burkholderia pseudomallei Disulfide bond formation protein B (dsbB)

Shipped with Ice Packs
In Stock

Description

Biological Role of DsbB in B. pseudomallei

DsbB is a transmembrane protein that regenerates the oxidized state of DsbA, allowing DsbA to catalyze disulfide bond formation in secreted virulence factors . Key roles include:

  • Redox recycling: DsbB reoxidizes DsbA via ubiquinone-mediated electron transfer, enabling DsbA to continually introduce disulfide bonds into substrates .

  • Virulence support: Knockout studies show that disrupting the DsbA-DsbB system attenuates B. pseudomallei in macrophages and murine infection models, reducing protease activity and motility .

Gene and Protein Characteristics

  • Gene locus: dsbB (BURPS1106A_2973) in B. pseudomallei strain 1106a .

  • Protein sequence: 169 amino acids, including a periplasmic domain with conserved cysteine residues critical for redox activity .

  • Conservation: Part of the core genome across 511 B. pseudomallei isolates, indicating evolutionary stability .

Comparison with Escherichia coli DsbB

FeatureB. pseudomallei DsbBE. coli DsbB
Active site cysteinesCys44, Cys49 (predicted)Cys41, Cys44
Interaction with DsbADistinct binding interface Canonical helix-helix docking
Redox potentialHigher oxidizing capacity Moderate

Expression and Purification

Recombinant DsbB is produced in E. coli systems with the following specifications :

  • Expression region: Residues 1–169.

  • Tag: Variable (determined during production).

  • Storage: Tris-based buffer with 50% glycerol at -20°C or -80°C.

Functional Assays

  • Interaction with DsbA: Surface plasmon resonance (SPR) confirms binding to DsbA, with a dissociation constant (K<sub>d</sub>) of ~15 µM .

  • Enzymatic activity: Restores protease and phospholipase C activity in ΔdsbA mutants when co-expressed .

Key Studies

  1. Attenuation in infection models:

    • ΔdsbA mutants show reduced intracellular survival in macrophages (13% viability vs. 57% in wild type at 10 h post-infection) .

    • Murine models infected with ΔdsbA exhibit 80% survival vs. 20% in wild-type controls .

  2. Substrate prediction:

    • Genomic analysis identifies 263 core B. pseudomallei proteins as putative DsbA-DsbB substrates, including metalloproteases (e.g., ZmpA) and β-lactamases .

Drug Discovery Potential

  • Target validation: DsbB is prioritized for structure-based inhibitor design due to its essential role in virulence .

  • High-throughput screening: Recombinant DsbB enables assays to identify small molecules disrupting DsbA-DsbB interaction .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will strive to fulfill your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, keep working aliquots at 4°C for up to one week.
Reconstitution
Before opening the vial, we recommend brief centrifugation to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotation for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, temperature, and protein stability. Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag type, please inform us, and we will prioritize development of your specified tag.
Synonyms
dsbB; BURPS1106A_2973; Disulfide bond formation protein B; Disulfide oxidoreductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-169
Protein Length
full length protein
Species
Burkholderia pseudomallei (strain 1106a)
Target Names
dsbB
Target Protein Sequence
MNNLTLSLRRERRLLVLLALVCLALLAGALYLQYVKNEDPCPLCIIQRYFFVLIAVFAFI GAGMASGAGVAVTEALIVLSAAAGVGTAARHLYVQLNPGFSCGFDALQPVVDSLPPARWL PGVFKVAGLCETVYPPIFGILLPGWALIAFVLIAVPVAVSLLRHRGRLR
Uniprot No.

Target Background

Function
Essential for disulfide bond formation in certain periplasmic proteins. It functions by oxidizing the DsbA protein.
Database Links
Protein Families
DsbB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Burkholderia pseudomallei and why is DsbB significant in this organism?

Burkholderia pseudomallei is a soil-dwelling bacterium endemic to Southeast Asia and northern Australia that causes melioidosis, a disease with stubbornly high mortality and complex treatment requirements . The disulfide bond formation protein B (DsbB) is significant because it forms a functional redox relay with disulfide bond protein A (BpsDsbA) and is essential for bacterial virulence . This protein pair catalyzes the oxidative folding of disulfide bonds in substrate proteins, which is critical for the proper folding and function of numerous virulence factors. Genomic analysis has demonstrated that dsbB is a highly conserved core gene across diverse B. pseudomallei clinical isolates , highlighting its evolutionary importance for this pathogen's survival and pathogenicity.

How does the DsbA-DsbB redox relay function in B. pseudomallei?

The DsbA-DsbB redox relay in B. pseudomallei functions as a critical oxidation system for proper protein folding. BpsDsbA acts as a highly oxidizing disulfide oxidoreductase that catalyzes the formation of disulfide bonds in unfolded or partially unfolded protein substrates . During this process, BpsDsbA itself becomes reduced. BpsDsbB, a membrane protein, then reoxidizes BpsDsbA, allowing it to catalyze additional rounds of disulfide bond formation .

This interaction has been characterized structurally through crystallography of BpsDsbA complexed with a 6-mer peptide (GFSCGF) derived from the second periplasmic loop of BpsDsbB . The crystal structure provides molecular details of how these proteins interact, with the BpsDsbB peptide binding to the catalytic surface of BpsDsbA. The continuous recycling of these proteins creates an efficient system for introducing disulfide bonds into numerous substrate proteins, many of which are critical virulence factors.

What experimental methods are used to evaluate DsbB function in B. pseudomallei?

Researchers employ several experimental approaches to evaluate DsbB function:

  • Genetic manipulation: Creation of dsbB deletion strains through allelic exchange mutagenesis to assess phenotypic changes .

  • Virulence assessment in infection models:

    • In vitro: Macrophage infection assays to measure intracellular bacterial survival

    • In vivo: BALB/c mouse models of infection to assess virulence attenuation

  • Biochemical assays: Evaluation of redox activity and interactions with partner proteins such as DsbA.

  • Structural studies: X-ray crystallography of DsbB-derived peptides complexed with BpsDsbA to characterize molecular interactions .

  • Genomic analysis: Comparative genomics to evaluate conservation of dsbB across clinical isolates and potential correlation with virulence profiles .

These methods collectively provide a comprehensive understanding of DsbB's functional role in B. pseudomallei pathogenesis and its potential as an antimicrobial target.

What evidence demonstrates that DsbB is required for B. pseudomallei virulence?

Multiple lines of evidence confirm DsbB's essential role in B. pseudomallei virulence:

  • In vivo attenuation: dsbB deletion strains show reduced virulence in BALB/c mouse models of infection, regardless of their in vitro phenotypes .

  • Conserved genomic presence: Genomic analysis shows dsbB is highly conserved across diverse B. pseudomallei clinical isolates, indicating selective pressure to maintain this gene .

  • Functional partner dependence: The functional partner of DsbB, the disulfide oxidoreductase DsbA, is also essential for virulence. ΔdsbA strains show reduced intracellular survival in macrophages and attenuated virulence in BALB/c mice .

  • Pleiotropic effects: Similar to ΔdsbA mutants, which display defects in secretion and motility, dsbB deletion likely affects multiple virulence pathways simultaneously .

These findings collectively establish DsbB as a critical virulence determinant in B. pseudomallei and validate it as a potential target for antimicrobial development.

What are the structural characteristics of the BpsDsbB-BpsDsbA interaction and how do they compare to homologous systems?

The BpsDsbB-BpsDsbA interaction has unique structural features that differentiate it from well-characterized homologous systems like Escherichia coli:

  • Peptide binding mode: A crystal structure at 2.5 Å resolution shows a 6-mer peptide (GFSCGF) derived from periplasmic loop 2 of BpsDsbB covalently binding to the catalytic surface of BpsDsbA . This interaction occurs via disulfide bond formation between the peptide cysteine and the BpsDsbA active site.

  • Differences from E. coli system: The 1.9 Å crystal structure of BpsDsbA revealed significant differences from E. coli DsbA (EcDsbA), particularly within the region surrounding the active site disulfide . These differences suggest that the BpsDsbA-BpsDsbB interaction is distinct from the EcDsbA-EcDsbB interaction, despite functional similarities.

  • Structural similarity to P. aeruginosa: BpsDsbA shows structural and activity similarity to DsbA from Pseudomonas aeruginosa (PaDsbA), with 44% sequence identity, suggesting potential conservation of interaction mechanisms across these pathogens .

  • Active site architecture: The BpsDsbA active site contains key features that make it highly oxidizing, similar to other DsbA proteins, but with pathogen-specific variations that could be exploited for selective inhibitor design.

These structural insights provide a foundation for structure-based drug design targeting the BpsDsbA-BpsDsbB interaction as a pathogen-specific antimicrobial strategy.

How can researchers express and purify recombinant B. pseudomallei DsbB for structural and functional studies?

Expressing and purifying functional recombinant B. pseudomallei DsbB presents significant challenges due to its membrane-embedded nature. Based on established methodologies for similar proteins, researchers should consider the following approach:

Expression Strategy:

  • Expression system selection: E. coli C41(DE3) or C43(DE3) strains are recommended for membrane protein expression.

  • Vector design: Include a C-terminal His-tag separated by a TEV protease cleavage site to facilitate purification while allowing tag removal.

  • Codon optimization: Optimize codons for E. coli expression to improve yield.

  • Expression conditions: Induce at low temperature (16-18°C) with low IPTG concentration (0.1-0.5 mM) to promote proper folding.

Purification Protocol:

  • Membrane extraction: Isolate bacterial membranes through differential centrifugation after cell lysis.

  • Detergent solubilization: Screen detergents (DDM, LMNG, or C12E8) for optimal solubilization of DsbB from membranes.

  • Affinity chromatography: Purify using Ni-NTA affinity chromatography with detergent in all buffers.

  • Size exclusion chromatography: Further purify using gel filtration to ensure homogeneity.

  • Functional verification: Assess activity through BpsDsbA reoxidation assays.

Quality Control:

  • Verify protein purity by SDS-PAGE

  • Confirm identity by mass spectrometry

  • Assess homogeneity by dynamic light scattering

  • Evaluate secondary structure by circular dichroism

This methodological approach addresses the challenges of membrane protein expression while providing high-quality protein for downstream structural and functional analyses.

What approaches can be used to identify inhibitors of the BpsDsbA-BpsDsbB interaction as potential antimicrobials?

A multi-faceted drug discovery approach targeting the BpsDsbA-BpsDsbB interaction should include:

Structure-Based Methods:

  • Virtual screening: Utilize the crystal structure of BpsDsbA complexed with the BpsDsbB-derived peptide to identify compounds that could disrupt this interaction.

  • Fragment-based screening: Screen fragment libraries against BpsDsbA to identify small molecules that bind at the BpsDsbB interaction interface.

  • Peptide mimetics: Design peptidomimetics based on the GFSCGF motif from BpsDsbB that could competitively inhibit the natural interaction.

Biochemical Screening Approaches:

  • High-throughput screening: Develop fluorescence-based assays to monitor BpsDsbA oxidation by BpsDsbB and screen for compounds that inhibit this reaction.

  • Thermal shift assays: Screen compounds that stabilize BpsDsbA in its reduced form, preventing interaction with BpsDsbB.

  • Surface plasmon resonance: Evaluate binding kinetics of potential inhibitors to immobilized BpsDsbA.

Biological Validation:

  • Bacterial growth inhibition: Test promising compounds for growth inhibition of B. pseudomallei.

  • Virulence factor expression: Assess the impact of inhibitors on expression and secretion of known DsbA/DsbB-dependent virulence factors.

  • Infection models: Evaluate efficacy in macrophage infection assays and murine models of melioidosis.

Considerations for Antimicrobial Development:

  • Focus on compounds with specificity for BpsDsbA-BpsDsbB over host proteins

  • Prioritize molecules with favorable pharmacokinetic properties for treating intracellular infections

  • Consider combination approaches with existing antibiotics

This comprehensive approach leverages structural insights to develop targeted inhibitors with potential clinical relevance for treating melioidosis.

How can one distinguish between direct and indirect effects when analyzing the phenotype of dsbB deletion mutants?

Distinguishing direct from indirect effects in dsbB deletion mutants requires a systematic experimental approach:

Complementation Studies:

  • Genetic complementation: Reintroduce wild-type dsbB on a plasmid or in the chromosome to verify phenotype restoration. Partial complementation may indicate indirect effects.

  • Heterologous complementation: Test whether dsbB from other bacteria can complement B. pseudomallei dsbB deletion, which may help identify conserved direct functions.

Biochemical Validation:

  • Substrate profiling: Identify proteins whose oxidation state changes in the dsbB mutant using redox proteomics approaches with thiol-reactive labels.

  • Direct interaction studies: Use pull-down assays or crosslinking approaches to identify proteins that directly interact with DsbB.

Time-Resolved Analyses:

  • Early vs. late phenotypes: Examine the temporal order of phenotypic changes following induction of dsbB deletion to help distinguish primary from secondary effects.

  • Conditional mutants: Create temperature-sensitive or inducible dsbB mutants to observe immediate consequences of DsbB inactivation.

Comparative Analysis:

  • Multiple strain comparison: The variable phenotypes observed among different dsbB deletion strains provide valuable insights - phenotypes consistent across all strains are more likely direct effects.

  • dsbA vs. dsbB mutant comparison: Compare phenotypes with dsbA mutants; shared phenotypes likely represent direct effects through the DsbA-DsbB pathway.

Molecular Analysis:

  • Transcriptome analysis: Compare gene expression profiles of wild-type and dsbB mutants to identify regulatory changes that may explain indirect effects.

  • Secretome analysis: Quantitatively compare proteins secreted by wild-type and mutant strains to identify directly affected substrates.

This methodological framework provides a comprehensive approach to distinguish direct DsbB functions from secondary consequences of disrupting this critical redox system.

What are the current gaps in understanding the DsbA-DsbB system in B. pseudomallei and how might they be addressed?

Several significant knowledge gaps exist in our understanding of the B. pseudomallei DsbA-DsbB system:

Complete Structural Characterization:

  • Full-length BpsDsbB structure: While a peptide-BpsDsbA complex structure exists , the complete structure of BpsDsbB remains undetermined. This could be addressed through:

    • Advanced membrane protein crystallography techniques

    • Cryo-electron microscopy of the BpsDsbA-BpsDsbB complex

    • Computational modeling validated by crosslinking experiments

Substrate Specificity:

  • Identification of specific substrates: The complete set of virulence factors dependent on DsbB-mediated oxidation is unknown. Approaches to address this include:

    • Comparative redox proteomics between wild-type and ΔdsbB strains

    • Identification of proteins with differential secretion or activity in ΔdsbB mutants

    • Direct trapping of DsbA-substrate intermediates

Regulatory Network:

  • Redox regulation: How environmental conditions affect DsbB activity remains poorly characterized. Research directions include:

    • Examining expression and activity under different infection-relevant conditions

    • Investigating potential regulatory proteins that might modulate DsbB function

    • Assessing whether DsbB participates in redox sensing beyond its oxidase function

Phylogenetic Diversity:

  • Strain-specific variations: The observed phenotypic diversity among ΔdsbB strains suggests potential strain-specific adaptations that require:

    • Comparative genomic analysis across clinical isolates

    • Functional characterization of DsbB variants

    • Assessment of how genomic background influences DsbB-dependent phenotypes

Host-Pathogen Interface:

  • Role during infection: How DsbB function changes during infection progression is poorly understood. This requires:

    • In vivo expression studies during different infection stages

    • Temporal requirement analysis using inducible expression systems

    • Identification of host factors that might interact with the DSB system

Addressing these knowledge gaps will require interdisciplinary approaches combining structural biology, genetics, biochemistry, and infection models to fully understand this complex redox system and its contribution to B. pseudomallei pathogenesis.

What strategies can be employed to identify the complete set of proteins dependent on the DsbB-DsbA system in B. pseudomallei?

Identifying the complete DsbB-DsbA dependent proteome requires a multi-pronged approach:

Redox Proteomics Strategy:

  • Differential thiol labeling: Compare wild-type and ΔdsbB strains using:

    • Iodoacetamide-based labeling of free thiols

    • Mass spectrometry to identify proteins with altered disulfide bond patterns

    • Quantitative analysis to prioritize significantly affected proteins

  • DIGE-based approach: Differential in-gel electrophoresis comparing:

    • Non-reducing vs. reducing conditions

    • Wild-type vs. ΔdsbB proteomes

    • Secreted vs. membrane-associated proteins

Genomic and Bioinformatic Approaches:

  • Predictive algorithms: Identify potential DsbA substrates based on:

    • Signal peptide presence

    • Even number of cysteine residues

    • Predicted disulfide bond formation sites

    • Homology to known DSB substrates in other bacteria

  • Comparative genomics: Correlate strain-specific virulence with genetic variations in potential substrate proteins.

Interaction-Based Methods:

  • Substrate trapping: Generate active site mutants of BpsDsbA (C33S) to trap mixed disulfides with substrates, followed by:

    • Affinity purification

    • Mass spectrometry identification

    • Validation through targeted approaches

  • Proximity labeling: Express BpsDsbA fused to a proximity labeling enzyme (e.g., APEX2) to identify proteins in close proximity during infection.

Functional Validation:

  • Targeted mutation: Confirm potential substrates by:

    • Mutating cysteine residues in candidate proteins

    • Assessing folding and function in wild-type and ΔdsbB backgrounds

    • Complementation studies with purified DsbA

  • Comparative phenotyping: Analyze phenotypic similarities between ΔdsbB and mutants lacking predicted substrate proteins.

This comprehensive approach would yield a prioritized list of DsbB-DsbA dependent proteins crucial for B. pseudomallei virulence and survival.

How can researchers develop and validate selective inhibitors targeting the B. pseudomallei DsbB protein?

A systematic approach to developing selective BpsDsbB inhibitors would include:

Target Characterization and Assay Development:

  • Enzyme kinetics: Establish assays measuring:

    • BpsDsbB-mediated reoxidation of BpsDsbA

    • Electron transfer to quinones

    • Coupled assays with model substrates

  • High-throughput screening assays:

    • Fluorescence-based redox state monitoring

    • FRET-based protein interaction disruption assays

    • Thermal shift assays for protein stabilization

Structure-Based Design Strategy:

  • Pharmacophore modeling: Based on the BpsDsbA-BpsDsbB peptide complex , develop:

    • Key interaction feature maps

    • Structure-based virtual screening queries

    • Fragment-growing strategies targeting the interaction interface

  • Membrane protein modeling: Since full-length BpsDsbB structure is unavailable:

    • Generate homology models based on E. coli DsbB

    • Validate through mutagenesis and crosslinking studies

    • Refine with molecular dynamics simulations

Compound Screening and Optimization:

  • Initial screening:

    • Fragment-based screening focusing on the BpsDsbB binding site of BpsDsbA

    • High-throughput virtual screening of compound libraries

    • Repurposing screens of approved drugs

  • Lead optimization:

    • Structure-activity relationship studies

    • Computer-aided drug design to improve potency and selectivity

    • Pharmacokinetic property optimization

Selectivity Assessment:

  • Counter-screening panel:

    • Human PDI and related thiol oxidoreductases

    • DsbB homologs from commensal bacteria

    • Other bacterial redox enzymes

  • Mechanism validation:

    • Target engagement in live bacteria

    • Phenotypic correlation with genetic deletion

Biological Validation:

  • Cellular activity:

    • MIC determination against B. pseudomallei

    • Activity against intracellular bacteria

    • Virulence factor inhibition profiling

  • In vivo validation:

    • BALB/c mouse models of acute and chronic melioidosis

    • Pharmacokinetic and pharmacodynamic characterization

    • Combination studies with standard-of-care antibiotics

This comprehensive approach would deliver well-characterized inhibitors with potential for development as novel antimicrobials against B. pseudomallei.

What techniques can be used to study the real-time dynamics of the DsbA-DsbB redox relay in living B. pseudomallei cells?

Studying the real-time dynamics of the DsbA-DsbB redox relay in living B. pseudomallei presents technical challenges but can be approached using several cutting-edge methodologies:

Fluorescence-Based Approaches:

  • Redox-sensitive fluorescent proteins: Engineer fusions with:

    • roGFP2 (redox-sensitive green fluorescent protein)

    • HyPer (H₂O₂-sensitive fluorescent protein)

    • rxYFP (redox-sensitive yellow fluorescent protein)
      These can be integrated into the chromosome to report on redox state changes at near-native expression levels.

  • FRET-based sensors: Develop DsbA-DsbB interaction reporters using:

    • Split fluorescent protein complementation

    • Donor-acceptor FRET pairs flanking key domains

    • Bimolecular fluorescence complementation (BiFC)

Real-Time Biochemical Approaches:

  • Alkylation-based redox state trapping: Use rapid cell permeabilization followed by:

    • N-ethylmaleimide (NEM) alkylation to trap thiol redox states

    • Mass spectrometry to quantify oxidized vs. reduced species

    • Targeted selected reaction monitoring for specific cysteines

  • Thiol-reactive probes: Apply membrane-permeable probes that:

    • React specifically with free thiols

    • Allow visualization by microscopy or flow cytometry

    • Permit quantification of oxidation states under different conditions

Advanced Microscopy Techniques:

  • Super-resolution microscopy: Track DsbA-DsbB localization using:

    • PALM/STORM for nanometer resolution

    • Structured illumination microscopy (SIM)

    • Single-molecule tracking to observe protein dynamics

  • Correlative light-electron microscopy: Connect fluorescence signals to ultrastructural features:

    • Immunogold labeling of DsbA/DsbB

    • Cryo-electron tomography for 3D context

    • Focused ion beam-scanning electron microscopy (FIB-SEM)

Infection Context Studies:

  • Host cell infection models: Monitor dynamics during:

    • Macrophage invasion and survival

    • Phagosomal escape

    • Intracellular replication phases

  • Inducible systems: Develop tools for:

    • Temporal control of DsbA/DsbB expression

    • Rapid perturbation of the redox relay

    • Synchronization of redox events

These methodologies would provide unprecedented insights into how the DsbA-DsbB redox relay functions during B. pseudomallei infection and responds to environmental stresses, informing both basic understanding and therapeutic targeting of this system.

How does the DsbB-DsbA system in B. pseudomallei compare with homologous systems in other bacterial pathogens?

The B. pseudomallei DsbB-DsbA system shares fundamental mechanisms with homologous systems in other bacteria but exhibits pathogen-specific adaptations:

Comparative Features Table:

FeatureB. pseudomalleiE. coliP. aeruginosaOther pathogens
DsbA sequence identityReference~24%44% Varies (20-45%)
Active site motifCPHCCPHCCPHCMostly conserved
Oxidizing powerHighly oxidizing Highly oxidizingHighly oxidizingVariable
DsbB interactionVia periplasmic loop 2 Via periplasmic loopsSimilar to E. coliGenerally conserved
Virulence requirementEssential VariableEssentialPathogen-specific
Genomic conservationHighly conserved UniversalConservedVariable
Structural uniquenessUnique features near active site Reference structureSimilar to B. pseudomalleiPathogen-specific variations

Key Comparative Insights:

This comparative analysis highlights both the conserved features that make DsbB a potential broad-spectrum target and the unique aspects that could allow for pathogen-specific therapeutic approaches.

How might environmental conditions encountered during infection affect the B. pseudomallei DsbB-DsbA system?

The DsbB-DsbA system must function under diverse and challenging conditions during B. pseudomallei infection. Understanding these environmental influences is crucial for therapeutic targeting:

pH Adaptation:

  • Structural resilience: Crystal structures of DsbA at different pH values (pH 5.0, 5.6, and 6.5) show the protein maintains its function across pH ranges relevant to different infection microenvironments .

  • Phagosomal survival: B. pseudomallei encounters acidic pH in phagosomes. The DsbB-DsbA system likely plays a role in maintaining protein function under these conditions by ensuring proper disulfide bond formation in acid-resistance proteins.

Oxidative Stress Response:

  • Redox homeostasis: During infection, B. pseudomallei faces host-generated reactive oxygen species (ROS). The DsbB-DsbA system may:

    • Help maintain virulence factor function under oxidative stress

    • Contribute to bacterial defense by ensuring proper folding of detoxifying enzymes

    • Function as part of a broader redox sensing network

  • Quinone pool interaction: DsbB transfers electrons to the respiratory chain via quinones. Changes in the quinone redox state during oxygen limitation could affect DsbB activity and subsequent virulence factor production.

Nutrient Availability:

  • Metabolic adaptation: Intracellular B. pseudomallei faces nutrient limitations that may affect:

    • Expression levels of DsbB and DsbA

    • Rates of disulfide bond formation due to energy constraints

    • Priorities for which substrates receive oxidative folding assistance

Host-Specific Signals:

  • Virulence regulation: Environmental cues in different host compartments may regulate:

    • Transcription of dsbB and dsbA

    • Expression of specific DsbB-DsbA dependent virulence factors

    • Preferential oxidation of certain substrate proteins

Temperature Fluctuations:

  • Thermal stability: During infection, B. pseudomallei transitions between environmental temperatures and the host's 37°C. The DsbB-DsbA system must:

    • Maintain function across this temperature range

    • Support temperature-dependent expression of virulence factors

    • Potentially participate in thermal stress responses

Understanding these environmental adaptations would inform therapeutic strategies that might be more effective in specific infection contexts and help explain the differential virulence observed among B. pseudomallei strains with varying adaptation to host environments .

What are the most promising approaches for developing antimicrobials targeting the B. pseudomallei DsbB-DsbA system?

Several promising approaches exist for developing antimicrobials targeting the B. pseudomallei DsbB-DsbA system, each with distinct advantages:

1. Direct Inhibition Strategies:

  • Competitive peptide mimetics:

    • Design based on the GFSCGF motif from BpsDsbB that binds BpsDsbA

    • Optimize for improved binding affinity and pharmacokinetic properties

    • Develop as peptidomimetics with non-peptide scaffolds to improve stability

  • Small molecule inhibitors targeting the DsbA active site:

    • Focus on the unique features of BpsDsbA active site compared to E. coli

    • Design compounds that stabilize the reduced form of BpsDsbA

    • Exploit the highly oxidizing nature of BpsDsbA to develop covalent inhibitors

  • Membrane-targeting DsbB inhibitors:

    • Design compounds that interfere with quinone binding

    • Develop inhibitors that disrupt DsbB membrane topology

    • Create dual-action compounds targeting both periplasmic loops of DsbB

2. Novel Delivery Approaches:

  • Trojan horse strategies:

    • Conjugate inhibitors to siderophores or other bacterial uptake systems

    • Develop nanoparticle formulations that can penetrate the difficult outer membrane

    • Create prodrug approaches activated by bacterial enzymes

  • Biofilm penetration:

    • Design inhibitors with anti-biofilm properties to address chronic infections

    • Combine with agents that disrupt extracellular matrix

    • Formulate for sustained release to maintain efficacy in biofilm environments

3. Combination Approaches:

  • Synergistic antibiotic combinations:

    • Identify antibiotics that show synergy with DsbB-DsbA inhibitors

    • Develop dual-action molecules targeting both DsbB-DsbA and another pathway

    • Create combinations addressing both acute infection and persistence

4. Immunomodulatory Strategies:

  • DsbB/DsbA-targeted vaccines:

    • Develop attenuated strains with modified DsbB-DsbA activity as live vaccines

    • Design subunit vaccines targeting surface-exposed regions of DsbB

    • Create adjuvant formulations enhancing immune responses against DsbB-DsbA dependent virulence factors

5. Anti-virulence Approaches:

  • Selective inhibition of key substrates:

    • Identify and target the most critical DsbB-DsbA dependent virulence factors

    • Develop compounds that specifically block oxidation of priority substrates

    • Create inhibitors that redirect DsbB-DsbA activity away from virulence factors

The most promising near-term approach combines structure-based design of BpsDsbA inhibitors based on the crystal structure with innovative delivery strategies to overcome the formidable cell envelope barriers of B. pseudomallei. Long-term success will likely require combination approaches that address multiple aspects of B. pseudomallei pathogenesis simultaneously.

What are the common challenges in working with recombinant B. pseudomallei DsbB and how can they be overcome?

Researchers face several significant challenges when working with recombinant B. pseudomallei DsbB:

Expression and Solubility Issues:

ChallengeSolution Approach
Toxicity in expression hostsUse tightly controlled inducible systems; C41/C43(DE3) E. coli strains; lower temperature induction
Membrane protein solubilityScreen multiple detergents (DDM, LMNG, GDN); consider protein fusion tags; use lipid nanodiscs for native-like environment
Low expression yieldOptimize codon usage; explore different promoter strengths; test insect cell or cell-free expression systems
Protein aggregationInclude stabilizing additives (glycerol, specific lipids); optimize buffer conditions; consider directed evolution for stability

Functional Assessment Difficulties:

ChallengeSolution Approach
Maintaining native conformationReconstitute in liposomes or nanodiscs; validate structure with circular dichroism and tryptophan fluorescence
Activity measurementDevelop coupled enzyme assays with BpsDsbA; use fluorescence-based redox potential monitoring; measure quinone reduction
Verification of proper foldingLimited proteolysis to assess folding state; thermal stability assays; native PAGE analysis
Partner protein interactionsDevelop pull-down assays with immobilized BpsDsbA; measure binding kinetics with SPR or BLI; use crosslinking approaches

Structural Characterization Barriers:

ChallengeSolution Approach
Crystallization difficultiesTry LCP crystallization; use antibody fragments to stabilize structure; explore detergent/lipid combinations
NMR spectroscopy limitationsFocus on specific domains or loops; use selective labeling strategies; consider solid-state NMR
Cryo-EM challengesIncrease protein molecular weight with fusion partners; optimize grid preparation; use phase plates for contrast enhancement
Conformational heterogeneityStabilize specific conformations with inhibitors or substrate analogs; engineer disulfide bonds to lock conformation

Biosafety Concerns:

ChallengeSolution Approach
BSL-3 requirements for native proteinWork with recombinant fragments expressed in safe hosts; develop robust inactivation protocols; use surrogate systems when appropriate
Strain handling limitationsEstablish collaborations with BSL-3 facilities; use genomic DNA rather than live cultures; create non-pathogenic surrogate expression systems
Shipping and transfer restrictionsPlan experiments accounting for regulatory requirements; ensure proper documentation and permits; consider synthetic gene approaches

These methodological solutions provide a framework for addressing the complex challenges associated with DsbB research, enabling more effective studies of this important antimicrobial target.

How can researchers analyze the impact of dsbB mutations on B. pseudomallei virulence with minimal confounding factors?

Analyzing the impact of dsbB mutations on B. pseudomallei virulence while minimizing confounding factors requires a carefully controlled experimental design:

Genetic Manipulation Strategy:

  • Clean deletion construction:

    • Use unmarked, in-frame deletion of dsbB

    • Confirm deletion by sequencing and Southern blot

    • Verify absence of polar effects on neighboring genes

    • Examine multiple independent deletion mutants

  • Precise complementation:

    • Restore dsbB at native locus using homologous recombination

    • Use native promoter to maintain physiological expression levels

    • Include epitope tags that don't interfere with function

    • Construct point mutants to dissect specific functional domains

Controlled Growth Conditions:

  • Standardized culture protocols:

    • Define precise growth conditions (media, temperature, aeration)

    • Harvest bacteria at identical growth phases

    • Standardize inoculum preparation methods

    • Account for growth rate differences in experimental design

  • Environmentally relevant conditions:

    • Test multiple conditions mimicking different infection stages

    • Include oxygen limitation, pH variation, and nutrient restriction

    • Assess biofilm formation under controlled conditions

    • Examine responses to oxidative stress

Comprehensive Phenotypic Analysis:

  • Virulence factor panel assessment:

    • Quantitatively measure multiple virulence factors

    • Include secretion, motility, adhesion, and invasion assays

    • Assess membrane integrity and envelope stress responses

    • Compare results across multiple B. pseudomallei strains

  • Infection model standardization:

    • Use multiple infection models (macrophages, epithelial cells)

    • Standardize host cell passage number and condition

    • Include appropriate controls for each step of infection

    • Perform time-course analyses to distinguish early from late effects

Statistical Rigor:

  • Experimental design optimization:

    • Calculate appropriate sample sizes through power analysis

    • Include biological and technical replicates

    • Design experiments to detect strain-specific variations

    • Use factorial designs to assess interaction effects

  • Advanced analytical approaches:

    • Apply multivariate analysis to identify confounding patterns

    • Use mixed models to account for batch effects

    • Implement Bayesian methods to integrate prior knowledge

    • Develop standardized effect size calculations for cross-study comparison

This systematic approach would allow researchers to confidently attribute phenotypic changes specifically to dsbB mutation rather than secondary effects, providing clearer insights into DsbB's role in B. pseudomallei virulence across different strain backgrounds.

What are the broader implications of targeting the DsbB-DsbA system for developing novel antimicrobials against B. pseudomallei and other bacterial pathogens?

Targeting the DsbB-DsbA system for antimicrobial development has far-reaching implications that extend beyond B. pseudomallei:

Antibiotic Resistance Circumvention:
The DsbB-DsbA system represents an alternative target to traditional antibiotic mechanisms. Since it is not directly targeted by current antibiotics, inhibitors would likely remain effective against multi-drug resistant strains. This approach addresses the critical need for new antimicrobial strategies against B. pseudomallei, which is intrinsically resistant to many antibiotics .

Anti-virulence Strategy:
DsbB-DsbA inhibitors would function as anti-virulence compounds rather than traditional bactericidal agents. This approach may reduce selective pressure for resistance development while disarming the pathogen, allowing host defenses to clear the infection. The attenuation observed in dsbB deletion strains suggests this approach could be effective.

Broad-Spectrum Potential:
The conservation of DsbB across diverse bacterial pathogens presents an opportunity for broad-spectrum application. While sufficient differences exist to develop pathogen-specific inhibitors , the core mechanism could be targeted for wider application against multiple Gram-negative pathogens with similar systems.

Host Microbiome Considerations:
Targeting a virulence-associated pathway rather than essential cellular functions may offer selectivity for pathogens over commensal bacteria. Since virulence factor requirements differ between pathogens and commensals, DsbB-DsbA inhibitors might have less impact on beneficial microbiota compared to conventional antibiotics.

Biodefense Applications:
As B. pseudomallei is classified as a Tier 1 select agent and potential bioterrorism threat, developing effective countermeasures has biodefense implications. DsbB-DsbA inhibitors could serve as part of the medical countermeasure arsenal against deliberate release scenarios.

Combination Therapy Platform:
The pleiotropic effects of DsbB-DsbA inhibition make it an excellent candidate for combination with existing antibiotics. By compromising multiple virulence systems simultaneously, such combinations could enhance efficacy while reducing resistance development.

Therapeutic Insight Transfer:
Structural and functional insights gained from studying the B. pseudomallei DsbB-DsbA system will inform drug development against related systems in other pathogens, potentially accelerating development of novel antimicrobials for multiple bacterial diseases.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.