Recombinant Burkholderia pseudomallei Glycerol-3-phosphate acyltransferase (plsY)
Description
Protein Characteristics
Recombinant PlsY is produced in Escherichia coli with an N-terminal His-tag for purification. Key specifications include:
Table 1: Recombinant PlsY Protein Overview
| Property | Details |
|---|---|
| Source | Burkholderia pseudomallei (strain 1710b) |
| Expression Host | E. coli |
| Protein Length | Full-length (203 amino acids) |
| Amino Acid Sequence | MQILLATVAAYLIGSVSFAVVVSAAMGLADPRSYGSKNPGATNVLRSGNKKAAILTLVGDAFKGW... |
| Purity | >90% (SDS-PAGE) |
| Storage | Lyophilized powder at -20°C/-80°C; Tris/PBS buffer with 6% trehalose |
| Reconstitution | 0.1–1.0 mg/mL in sterile water; 50% glycerol for long-term stability |
| UniProt ID | Q3JVC1 |
The enzyme is annotated as a glycerol-3-phosphate acyltransferase (GPAT; EC 2.3.1.n3) and is also termed acyl-phosphate–glycerol-3-phosphate acyltransferase or lysophosphatidic acid synthase .
Genomic Context
PlsY is encoded by the plsY gene (locus tag: BURPS1710b_1070) located on the large chromosome (Chromosome 1) of B. pseudomallei. Chromosome 1 harbors genes essential for core metabolic processes, contrasting with the smaller chromosome, which contains accessory genes for environmental adaptation . This genomic positioning underscores PlsY’s role in central lipid metabolism.
Enzymatic Function
PlsY catalyzes the transfer of an acyl group from acyl-phosphate to G3P, forming 1-acyl-LPA. This reaction is critical for:
-
Membrane biogenesis: Generating phospholipid precursors.
-
Metabolic flexibility: Contributing to pathways like polyhydroxyalkanoate (PHA) synthesis under nutrient-limited conditions .
Genomic Plasticity and Pathogenicity
B. pseudomallei’s genome includes 16 genomic islands (GIs) that enhance adaptability. While plsY itself is not located within a GI, its role in lipid metabolism intersects with pathways influenced by horizontally acquired genes, such as those involved in PHA synthesis .
Metabolic Engineering Insights
PlsY supplies precursors for both membrane lipids and storage polymers like PHAs. In Burkholderia species, G3P derived from glycolysis or gluconeogenesis is funneled into PHAs under stress, highlighting PlsY’s dual metabolic role .
Applications
-
Enzyme characterization: Used in kinetic assays to study substrate specificity and inhibitor screening .
-
Drug discovery: A potential target for antimicrobials due to its essential role in membrane biosynthesis.
-
Structural biology: Available recombinant protein enables crystallographic studies to resolve catalytic mechanisms .
Product Specs
Note: We prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Note: Our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Target Background
KEGG: bpm:BURPS1710b_1070
