Recombinant Burkholderia pseudomallei Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Burkholderia pseudomallei Large-conductance Mechanosensitive Channel (mscL)

The Recombinant Burkholderia pseudomallei Large-conductance mechanosensitive channel (mscL) is a protein derived from the bacterium Burkholderia pseudomallei, which is the causative agent of melioidosis, a severe infectious disease prevalent in tropical regions. Mechanosensitive channels like mscL are crucial for bacterial survival under osmotic stress by allowing the efflux of ions and small molecules to maintain cellular integrity.

Structure and Function of mscL

  • Structure: The mscL protein is a pentameric structure composed of five identical subunits. Each subunit contains two transmembrane helices (TM1 and TM2) connected by a periplasmic loop. The channel's pore is formed by the TM1 helices, which are highly conserved across different species .

  • Function: mscL channels are activated by membrane tension, allowing them to open and release ions and small molecules from the cell. This function is essential for maintaining cellular osmotic balance and preventing lysis under conditions of rapid osmotic changes .

Recombinant Production and Characteristics

  • Production: Recombinant Burkholderia pseudomallei mscL is produced using molecular biology techniques, where the gene encoding mscL is cloned into an expression vector and expressed in a suitable host organism. This allows for large-scale production of the protein for research and potential therapeutic applications .

  • Characteristics: The recombinant mscL protein is typically stored in a Tris-based buffer with 50% glycerol to maintain stability. It is recommended to store the protein at -20°C or -80°C to prevent degradation. Working aliquots can be stored at 4°C for up to one week .

Research Findings and Applications

  • Biological Significance: Understanding the structure and function of mscL in Burkholderia pseudomallei can provide insights into the pathogen's survival mechanisms and potential targets for therapeutic intervention. Research on mscL may also contribute to the development of novel antimicrobial strategies .

  • Potential Applications: The study of mechanosensitive channels like mscL can inform the design of new drugs or treatments targeting bacterial osmotic regulation. Additionally, recombinant mscL proteins can be used as tools in biotechnology for developing sensors or devices sensitive to mechanical stress .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mscL; BURPS668_2373; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-143
Protein Length
full length protein
Species
Burkholderia pseudomallei (strain 668)
Target Names
mscL
Target Protein Sequence
MSIIKEFKEFAVKGNVMDLAIGVIIGGAFSKIVDSVVKDLIMPVIGVLTGGLDFSNKFVL LGQIPASFKGNPESFKDLQAAGVATFGYGSFITVLINFIILAFIIFLMVKFINKLRKPEE AAPAATPEDVLLLREIRDSLKQR
Uniprot No.

Target Background

Function
A membrane channel activated by stretch forces in the lipid bilayer. It may play a role in regulating cellular osmotic pressure.
Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.