Recombinant Burkholderia pseudomallei Lipid A export ATP-binding/permease protein MsbA (msbA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: Our standard shipping includes blue ice packs. If you require dry ice, please contact us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference for your preparation.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form can be stored for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
msbA; BURPS1710b_1357; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-596
Protein Length
full length protein
Species
Burkholderia pseudomallei (strain 1710b)
Target Names
msbA
Target Protein Sequence
MSVKPTLSKPIGGQDASSPAVVMRRLWPYVKPLVWVLVAGVLAMAAVAATEAGIPALLKP LLDHGFGSKGDMTTKLYVPAAVVGLALARAIAQYASGYLLQYVSNRILLDLRIQMFERMI HTGVSFFQRETASTVINAVVFEVNQVLSVLMGVTITLVRDSLTVVFLLGYLFYLNWRLTL IVAILLPCIGWLVGKINRRLRRLNREHQTLTNQLAYIVEETVGGYKVVKVHNGEPYEIGR FNELSRKLRGYSMRMTVSGGLAQPLTQFLASIALAVVLTIAVVQSANDQTTVGGFVAFVT AMLLIISPLKHLMDVNQPLQRGMTAAELIFGLIDEPREPEGGGKPLARASGAIEFSHVSF SYGMSRDGRQTLDDVSFTVAPGEMVALAGPSGSGKTTLVNLLPRFFDPSSGSVRVDGVAL PEYSLRDLRNQIAMVSQDVVLFNDTIAANVAYGQAPERDRVEAALRAANLWETVTAMPDG IDTLVGDNGMRLSGGQRQRLAIARAIYKDAPILILDEATSALDSESERHVQAALETLMKG RTTLVIAHRLSTIERADRILVLEGGKIVESGSHRELLEQGGLYAHLHRIQFQQDAG
Uniprot No.

Target Background

Function
This protein plays a crucial role in lipopolysaccharide (LPS) biosynthesis. It facilitates the translocation of lipid A-core from the inner to the outer leaflet of the inner membrane. The transmembrane domains (TMD) form a pore in the inner membrane, while the ATP-binding domain (NBD) provides the energy for this process.
Database Links
Protein Families
ABC transporter superfamily, Lipid exporter (TC 3.A.1.106) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure and function of B. pseudomallei MsbA protein?

B. pseudomallei MsbA is a lipid A export ATP-binding/permease protein that functions as an ABC transporter essential for the biogenesis of the outer membrane in this Gram-negative bacterium. The protein consists of 596 amino acids with a full-length expression region, as indicated in the product information . The amino acid sequence reveals characteristic ATP-binding cassette domains and transmembrane regions typical of ABC transporters. Functionally, MsbA is responsible for the translocation of lipid A molecules across the inner membrane, a critical step in lipopolysaccharide (LPS) biosynthesis. The protein contains conserved Walker A and Walker B motifs that are essential for ATP binding and hydrolysis, which powers the conformational changes necessary for substrate transport.

How does B. pseudomallei MsbA compare to similar proteins in other bacterial species?

B. pseudomallei MsbA shares structural homology with other bacterial ABC transporters but has specific adaptations that may contribute to the pathogen's resilience. While the core ABC transporter structure is conserved, B. pseudomallei MsbA exhibits unique sequence characteristics, particularly in its substrate-binding pocket and transmembrane domains. Unlike the well-characterized Escherichia coli DsbA protein, which shows distinct differences in its active site region that affects partner protein interactions , B. pseudomallei MsbA likely has evolved specific substrate recognition patterns optimized for the bacterium's LPS composition. These differences may contribute to the bacterium's antibiotic resistance profile and survival within host cells, making comparative analysis between species valuable for understanding pathogen-specific mechanisms.

What is the gene organization and expression pattern of msbA in B. pseudomallei?

The msbA gene in B. pseudomallei is identified as BPSL1118 in the bacterial genome . Its expression is likely regulated in response to environmental conditions encountered during infection, including nutrient availability, pH changes, and host immune responses. The gene typically exhibits constitutive expression due to its essential role in outer membrane biogenesis, with potential upregulation during specific stress conditions. Research methodologies to analyze its expression pattern include quantitative RT-PCR, RNA-seq analysis across different growth conditions, and reporter gene fusion studies. Investigators should consider analyzing expression patterns under conditions that mimic host environments, such as macrophage infection models, which would provide insights into the regulation of this gene during pathogenesis.

What are the optimal conditions for expressing and purifying recombinant B. pseudomallei MsbA?

The expression and purification of recombinant B. pseudomallei MsbA requires specific conditions to obtain functionally active protein. Based on standard protocols for membrane proteins, expression in E. coli systems using specialized strains like C41(DE3) or C43(DE3) that are designed for membrane protein expression is recommended. Induction should be performed at lower temperatures (16-20°C) to prevent inclusion body formation. For purification, a multi-step approach is advisable:

  • Membrane fraction isolation using ultracentrifugation after cell lysis

  • Solubilization with mild detergents such as n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG)

  • Immobilized metal affinity chromatography (IMAC) utilizing the protein's tag

  • Size exclusion chromatography for final purification

Storage should be at -20°C in a Tris-based buffer with 50% glycerol as indicated in the product information . For functional studies, reconstitution into proteoliposomes may be necessary to assess ATPase activity and transport function.

What assays are available to measure the functional activity of B. pseudomallei MsbA?

Multiple complementary assays can be employed to assess the functionality of B. pseudomallei MsbA:

  • ATPase Activity Assay: Measures ATP hydrolysis using either colorimetric phosphate detection (malachite green assay) or coupled enzyme assays (pyruvate kinase/lactate dehydrogenase system)

  • Lipid Flippase Assay: Utilizes fluorescently labeled lipid analogues to monitor transport across reconstituted proteoliposome membranes

  • Substrate Binding Assays: Including surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) to determine binding kinetics and affinity for lipid A

  • Complementation Studies: Testing the ability of B. pseudomallei MsbA to rescue growth in conditional E. coli MsbA mutants

  • Transport Assays in Reconstituted Systems: Using radiolabeled or fluorescently tagged lipid A substrates to directly measure transport activity

When designing functional assays, researchers should include appropriate controls, such as ATPase-deficient mutants (mutations in Walker A/B motifs) and assess substrate specificity using various lipid compounds.

How can researchers generate effective antibodies against B. pseudomallei MsbA for immunodetection?

Generating effective antibodies against B. pseudomallei MsbA requires careful design due to the protein's membrane-embedded nature. A recommended approach includes:

  • Antigen Selection: Choose hydrophilic, surface-exposed regions of the protein based on structural predictions. The ATP-binding domain or extracellular loops are preferable targets.

  • Peptide Synthesis vs. Domain Expression: Either synthesize peptides corresponding to selected epitopes or express soluble domains (particularly the nucleotide-binding domain) for immunization.

  • Immunization Strategy: Employ a prime-boost regimen in rabbits or mice, using Freund's complete adjuvant for primary immunization followed by incomplete adjuvant for boosters.

  • Antibody Purification: Perform affinity purification using the immunizing antigen to reduce cross-reactivity.

  • Validation: Validate antibody specificity using multiple techniques including Western blotting with recombinant protein, immunoprecipitation, and testing against msbA knockout strains as negative controls.

For monoclonal antibody development, researchers should screen hybridoma supernatants against both native and denatured forms of the protein to identify antibodies that recognize conformational versus linear epitopes.

What is the relationship between MsbA function and antibiotic resistance in B. pseudomallei?

B. pseudomallei exhibits intrinsic resistance to multiple antibiotics, a characteristic that complicates treatment of melioidosis . MsbA's role in this resistance is multifaceted:

  • Permeability barrier maintenance: By ensuring proper LPS assembly, MsbA indirectly maintains the outer membrane permeability barrier that restricts antibiotic entry

  • Efflux contribution: As an ABC transporter, MsbA may directly contribute to the efflux of certain antibiotics, though its primary substrate is lipid A

  • Membrane stress response: MsbA function may be integrated into membrane stress responses that are activated upon antibiotic exposure

Experimental approaches to study this relationship include:

  • Generating conditional msbA mutants and assessing changes in minimum inhibitory concentrations (MICs) for various antibiotics

  • Analyzing MsbA expression in response to antibiotic exposure

  • Studying the impact of MsbA inhibitors on antibiotic susceptibility

The relationship between MsbA and antibiotic resistance makes it a potential target for adjuvant therapies designed to enhance antibiotic efficacy against this difficult-to-treat pathogen.

What are the key structural features of B. pseudomallei MsbA that differentiate it from homologs in other bacteria?

B. pseudomallei MsbA possesses specific structural features that distinguish it from homologs in other bacterial species. Based on the protein sequence and comparative analysis:

  • ATP-binding pocket variations: Subtle amino acid differences in the Walker A and Walker B motifs may influence ATP binding and hydrolysis kinetics

  • Transmembrane domain composition: The amino acid sequence reveals unique residues in the transmembrane helices that likely affect substrate specificity

  • Connecting loops and regulatory regions: Variations in the extracellular and periplasmic loops may influence interactions with other membrane components

Researchers studying these differences should employ advanced structural biology techniques including:

  • X-ray crystallography of the purified protein

  • Cryo-electron microscopy to capture different conformational states

  • Molecular dynamics simulations to analyze structure-function relationships

These structural features may explain adaptation to the specific lipid A structure found in B. pseudomallei and could provide insights into species-specific inhibitor development.

How does the ATP hydrolysis cycle couple with lipid A transport in B. pseudomallei MsbA?

The coupling between ATP hydrolysis and lipid A transport in MsbA follows a complex mechanistic cycle that can be investigated through several experimental approaches:

  • Conformational change analysis: Using techniques like FRET (Förster Resonance Energy Transfer) with strategically placed fluorophores to monitor protein conformational changes during the transport cycle

  • Trapped intermediate states: Generating mutants locked in specific conformations or using non-hydrolyzable ATP analogs to trap intermediates

  • Single-molecule studies: Applying single-molecule FRET or force spectroscopy to analyze the dynamics of individual transport events

The current model suggests a mechanism where:

  • ATP binding induces dimerization of the nucleotide-binding domains

  • This dimerization drives conformational changes in the transmembrane domains

  • These changes alter accessibility of the substrate-binding pocket from inward-facing to outward-facing

  • ATP hydrolysis resets the transporter to its initial state

Researchers should investigate whether B. pseudomallei MsbA exhibits unique regulatory features in this cycle compared to well-characterized homologs from other species.

What strategies can be employed to develop inhibitors specific for B. pseudomallei MsbA?

Developing specific inhibitors for B. pseudomallei MsbA represents a promising approach for new antimicrobials against this antibiotic-resistant pathogen. Several strategic approaches include:

  • Structure-based drug design: Utilizing structural data (either experimentally determined or homology models) to identify unique binding pockets that differ from human ABC transporters

  • High-throughput screening: Developing assays suitable for screening compound libraries, such as:

    • ATP hydrolysis inhibition assays

    • Fluorescence-based transport assays in reconstituted systems

    • Cell-based assays using conditional MsbA mutants

  • Fragment-based approaches: Identifying small molecular fragments that bind to specific regions of MsbA and then optimizing these into larger, more potent inhibitors

  • Peptidomimetics: Designing peptides that mimic natural interaction partners of MsbA to disrupt its function

  • Natural product screening: Evaluating microbially-derived compounds with known activity against related transporters

Researchers should focus on inhibitors that target unique features of B. pseudomallei MsbA to minimize off-target effects on human ABC transporters, which share structural similarities but distinct functional roles.

How can MsbA-based approaches be integrated into multi-target strategies for treating melioidosis?

Effective treatment strategies for melioidosis require multi-targeted approaches due to B. pseudomallei's intrinsic resistance mechanisms. MsbA-targeted therapies can be integrated through:

  • Combination therapies: Pairing MsbA inhibitors with conventional antibiotics to increase permeability and reduce efflux:

    • β-lactam antibiotics + MsbA inhibitors

    • Aminoglycosides + MsbA inhibitors

    • Macrolides + MsbA inhibitors

  • Dual-targeting molecules: Developing hybrid compounds that simultaneously inhibit MsbA and another essential target

  • Adjuvant approach: Using MsbA inhibitors not as direct antimicrobials but as resistance-breaking adjuvants

  • Virulence attenuation: Partial inhibition of MsbA to compromise bacterial fitness and virulence without directly killing bacteria, potentially reducing selection pressure for resistance

This multi-targeted approach is particularly relevant given the demonstration that disruption of other essential proteins like DsbA significantly attenuates B. pseudomallei in both cellular and animal infection models , suggesting that targeting membrane biogenesis pathways offers promising therapeutic potential.

What are the most effective methods for studying MsbA-substrate interactions in B. pseudomallei?

Investigating MsbA-substrate interactions requires sophisticated biophysical and biochemical techniques:

TechniqueApplicationAdvantagesLimitations
Surface Plasmon Resonance (SPR)Binding kinetics determinationReal-time, label-free detectionRequires immobilization that may affect protein function
Isothermal Titration Calorimetry (ITC)Thermodynamic parameters of bindingDirect measurement of binding energyHigh protein consumption
Nuclear Magnetic Resonance (NMR)Structural details of interactionAtomic-level interaction detailsSize limitations for membrane proteins
Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS)Conformational changes upon substrate bindingMaps dynamic protein regionsLower resolution than atomic structures
Molecular Dynamics SimulationsInteraction modelingCaptures dynamic aspects of bindingRequires validation with experimental data

When applying these techniques to B. pseudomallei MsbA, researchers should:

  • Prepare lipid A substrates that accurately represent the native substrate

  • Consider the membrane environment's impact on binding interactions

  • Compare natural substrates with potential inhibitor molecules

  • Analyze how substrate binding affects ATP hydrolysis rates

These approaches can reveal the molecular basis of substrate specificity and provide insights for rational drug design.

How can CRISPR-Cas systems be utilized to study MsbA function in B. pseudomallei?

CRISPR-Cas technology offers powerful approaches to study essential genes like msbA in B. pseudomallei, overcoming traditional challenges in genetic manipulation of this pathogen:

  • Conditional knockdown systems:

    • CRISPRi (CRISPR interference) with a catalytically inactive Cas9 (dCas9) to achieve tunable repression of msbA expression

    • Inducible promoter systems to control expression levels

  • Precise gene editing:

    • Introduction of point mutations to study specific residues involved in substrate binding or ATP hydrolysis

    • Creation of tagged versions for localization studies

  • Domain swapping experiments:

    • Replacing domains with corresponding regions from other bacterial MsbA proteins to identify specificity determinants

  • Promoter modifications:

    • Altering expression levels to study dosage effects on antibiotic resistance and virulence

When implementing CRISPR-Cas systems in B. pseudomallei, researchers must address biosafety considerations due to the organism's classification as a Tier 1 select agent, often requiring work in specialized BSL-3 facilities. Additionally, optimization of delivery methods for CRISPR components is essential, with electroporation or conjugation typically offering the highest efficiency for this organism.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.