Recombinant Burkholderia pseudomallei Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format readily available in our inventory. However, if you have specific format preferences, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Kindly consult your local distributors for precise delivery times.
Note: All protein shipments are standardly accompanied by normal blue ice packs. Should you require dry ice shipping, please communicate with us beforehand, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration ranging from 0.1 to 1.0 mg/mL. For long-term storage, we advise adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is contingent upon various factors including storage conditions, buffer constituents, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form exhibits a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquot the protein. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is decided during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
lspA; BURPS668_0966; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-166
Protein Length
full length protein
Species
Burkholderia pseudomallei (strain 668)
Target Names
lspA
Target Protein Sequence
MAKTLSKSSGGALAPWLGISLIVILFDQLTKIAVLKTFAYGAMHALTPFFNLTLIYNRGA AFGFLATAGGWQRWAFTALGIGATLVICYLLKRHGHQRLFSLSLALILGGALGNVIDRLI YGHVIDFLDFHVGAWHWPAFNLADSAITVGAVLLIYDELRRVRGAR
Uniprot No.

Target Background

Function
This protein specifically catalyzes the removal of signal peptides from prolipoproteins.
Database Links
Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Lipoprotein signal peptidase (LspA) and what is its role in Burkholderia pseudomallei?

Lipoprotein signal peptidase (LspA) is a critical membrane-bound enzyme involved in the maturation of bacterial lipoproteins. In Burkholderia pseudomallei, the causative agent of melioidosis, LspA functions by cleaving the signal peptide from prolipoproteins after they have been modified with a diacylglyceryl group at the conserved cysteine residue in the lipobox consensus sequence [L(VI)−3-A(STVI)−2-G(AS)−1-C*+1] .

The enzyme plays a crucial role in the proper processing and localization of numerous lipoproteins that contribute to B. pseudomallei pathogenesis, including those involved in nutrient acquisition, cell wall integrity, and virulence. As B. pseudomallei causes severe infections with mortality rates up to 50% in untreated cases, understanding LspA function is fundamental to developing novel therapeutic approaches .

What expression systems are most effective for recombinant B. pseudomallei LspA production?

For recombinant expression of B. pseudomallei LspA, Escherichia coli-based expression systems have proven effective, particularly when employing specialized strains designed for membrane protein expression such as C43(DE3). Based on successful approaches with homologous proteins, the methodology typically involves:

  • Gene optimization with codon adaptation for E. coli expression

  • Incorporation into vectors like pET28a with appropriate fusion tags (e.g., hexahistidine)

  • Expression in TB (Terrific Broth) media supplemented with appropriate antibiotics

  • Induction with IPTG at moderate temperatures (28-30°C) rather than 37°C

  • Extended expression periods (16-18 hours) to maximize protein yield

Expression levels should be carefully monitored, as overexpression of membrane proteins can lead to toxicity and inclusion body formation. Temperature, inducer concentration, and cell density at induction time are critical parameters requiring optimization for each specific construct.

What purification strategies yield highest purity and activity for recombinant B. pseudomallei LspA?

Purification of recombinant B. pseudomallei LspA presents significant challenges due to its membrane-embedded nature. Effective strategies include:

  • Cell disruption using techniques that preserve membrane protein integrity (French press or sonication with cooling)

  • Membrane fraction isolation through differential centrifugation

  • Solubilization using appropriate detergents (typically DDM, LDAO, or C8E4)

  • Immobilized metal affinity chromatography (IMAC) utilizing the hexahistidine tag

  • Size exclusion chromatography for further purification and buffer exchange

The choice of detergent is particularly critical, as it must efficiently extract LspA from membranes while maintaining its native conformation and activity. In published studies with LspA from other organisms, detergent screening is often necessary to identify optimal conditions .

How can researchers verify the activity of purified recombinant B. pseudomallei LspA?

Activity assessment of purified recombinant B. pseudomallei LspA can be accomplished through several complementary methods:

  • Gel-shift assays: Using a model prolipoprotein substrate (such as proICP) to detect LspA-mediated cleavage via migration differences on SDS-PAGE

  • FRET-based assays: Employing fluorescently labeled peptide substrates containing the lipobox sequence to measure cleavage kinetics in real-time

  • Mass spectrometry: Detecting specific cleavage products following incubation with synthetic or recombinant prolipoprotein substrates

  • Inhibition studies: Measuring activity reduction in the presence of known LspA inhibitors like globomycin or myxovirescin

Each method provides different insights into enzyme activity, with gel-shift assays offering qualitative assessment and FRET-based approaches enabling quantitative kinetic analysis .

What structural features distinguish B. pseudomallei LspA from homologs in other bacterial species?

While specific structural data for B. pseudomallei LspA remains limited, comparative analysis with characterized homologs such as those from Staphylococcus aureus provides valuable insights into potential distinctive features:

  • The catalytic mechanism likely involves conserved aspartate residues forming a catalytic dyad similar to other LspA proteins

  • B. pseudomallei LspA is expected to contain four transmembrane helices (H1-H4) arranged orthogonally to create a space for the signal peptide accommodation

  • The β-cradle region likely accommodates the diacylglyceryl moiety of the substrate

  • Sequence variations in the extracellular loops and substrate-binding pocket may confer different substrate specificities or inhibitor sensitivities compared to other species

Understanding these structural nuances is crucial for structure-based drug design efforts targeting B. pseudomallei LspA with high specificity.

What are the methodological approaches for crystallizing B. pseudomallei LspA for structural studies?

Crystallization of membrane proteins like B. pseudomallei LspA presents significant technical challenges. Based on successful approaches with related proteins, recommended methodologies include:

  • Lipidic cubic phase (LCP) crystallization:

    • Using monoolein as host lipid

    • Screening various precipitants and additives

    • Optimizing protein:lipid ratios and temperature conditions

  • Detergent optimization:

    • Screening multiple detergents for stability and homogeneity

    • Considering amphipols or nanodiscs for enhanced stability

  • Construct design considerations:

    • Testing truncations or terminal modifications

    • Incorporating fusion proteins to enhance crystal contacts

    • Employing thermostabilizing mutations

  • Co-crystallization with inhibitors:

    • Using known inhibitors like globomycin or myxovirescin to stabilize protein conformation

    • Optimizing inhibitor concentration and incubation conditions

Data collection for resulting crystals would typically require synchrotron radiation due to the often small and weakly diffracting nature of membrane protein crystals.

How can inhibition studies of B. pseudomallei LspA inform drug development strategies?

Inhibitor studies with B. pseudomallei LspA provide critical insights for structure-based drug design approaches:

  • Comparative inhibition profiling:

    • Determining IC50 values for known inhibitors (globomycin, myxovirescin)

    • Establishing structure-activity relationships

    • Comparing inhibition patterns with homologs from other species

  • Inhibition mechanism analysis:

    • Determining competitive versus non-competitive inhibition patterns

    • Identifying binding site interactions through mutagenesis studies

    • Characterizing resistance-conferring mutations

  • In vitro to in vivo translation:

    • Correlating enzymatic inhibition with antimicrobial activity

    • Assessing inhibitor effects on B. pseudomallei growth and virulence

    • Evaluating inhibitor effectiveness in cell infection models

InhibitorStructure TypeLspA Binding ModePotential Advantages for B. pseudomallei
GlobomycinCyclic peptideMimics lipobox sequenceWell-characterized inhibition mechanism
MyxovirescinMacrolactam lactoneDistinct from globomycinAlternative scaffolds for drug development

Understanding these inhibition patterns can guide the development of novel therapeutic agents against B. pseudomallei infections .

What mutagenesis approaches best identify functional domains in B. pseudomallei LspA?

Targeted mutagenesis provides valuable insights into structure-function relationships in B. pseudomallei LspA:

  • Alanine scanning mutagenesis:

    • Systematic replacement of conserved residues with alanine

    • Focus on predicted catalytic residues and substrate-binding regions

    • Assessment of effects on enzyme activity and inhibitor binding

  • Domain swapping:

    • Creating chimeric proteins with homologous regions from related bacteria

    • Identifying domains responsible for substrate specificity

    • Mapping inhibitor resistance determinants

  • Site-directed mutagenesis:

    • Targeting specific residues based on homology modeling

    • Creating mutations observed in inhibitor-resistant strains

    • Engineering modified activity or specificity

When conducting these studies, researchers should consider using appropriate biosafety facilities as B. pseudomallei is classified as a Tier 1 select agent with high infectivity via inhalation .

How does B. pseudomallei LspA contribute to lipopolysaccharide (LPS) processing and virulence?

While direct evidence linking B. pseudomallei LspA to LPS processing remains limited, integrative research approaches can elucidate these connections:

  • Conditional knockdown studies:

    • Creating regulatable LspA expression systems

    • Assessing effects on LPS biosynthesis and export

    • Quantifying changes in LPS structure and modification patterns

  • Lipoprotein identification:

    • Proteomic analysis of mature lipoproteins dependent on LspA processing

    • Identifying lipoproteins involved in LPS biosynthesis or modification

    • Characterizing changes in the lipoproteome upon LspA inhibition

  • Virulence correlation:

    • Evaluating LspA inhibition effects on host cell adhesion and invasion

    • Measuring impact on resistance to host defense mechanisms

    • Assessing changes in inflammatory responses to B. pseudomallei LPS

B. pseudomallei LPS is recognized as an important vaccine candidate due to its contribution to virulence, with distinct O-antigen structures that can elicit protective immune responses . Understanding LspA's role in lipoprotein maturation may reveal indirect effects on LPS biosynthesis pathways.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.