Recombinant Burkholderia pseudomallei Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your desired format in the order notes, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery time estimates.
Note: Our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be established during production. If you have a particular tag type preference, please inform us, and we will prioritize developing it accordingly.
Synonyms
yidC; BURPS668_0093; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-558
Protein Length
full length protein
Species
Burkholderia pseudomallei (strain 668)
Target Names
yidC
Target Protein Sequence
MDIKRTVLWVIFFMSAVMLFDNWQRSHGRPSMFFPNVTQTNTASNATNGNGASGANAAAA ANALPAAATGAAPATTAPAAQAQLVRFSTDVYNGEIDTRGGTLAKLTLTKAGDGKQPDLS VTLFDHTANHTYLARTGLLGGDFPNHNDVYAQVAGPTSLAADQNTLKLSFESPVKGGVKV VKTYTFTRGSYVIGVDTKIENVGAAPVTPSVYMELVRDNSSVETPMFSHTFLGPAVYTDQ KHFQKITFGDIDKNKADYVTSADNGWIAMVQHYFASAWIPQSGAKRDIYVEKIDPTLYRV GVKQPVAAIAPGQSADVSARLFAGPEEERMLEGIAPGLELVKDYGWVTIIAKPLFWLLEK IHGFVGNWGWAIVLLTLLIKAVFFPLSAASYKSMARMKEITPRMQALRERFKSDPQKMNA ALMELYKTEKVNPFGGCLPVVIQIPVFISLYWVLLASVEMRGAPWVLWIHDLSQRDPYFI LPVLMAVSMFVQTKLNPTPPDPVQAKMMMFMPIAFSVMFFFFPAGLVLYYVVNNVLSIAQ QYYITRTLGGAAAKKKAS
Uniprot No.

Target Background

Function
YidC is essential for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. It participates in the integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins. YidC also aids in the folding of multispanning membrane proteins.
Database Links
Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Membrane Protein Insertase YidC and what is its role in Burkholderia pseudomallei?

Membrane Protein Insertase YidC, also known as Foldase YidC or Membrane integrase YidC, is a critical membrane protein in B. pseudomallei responsible for facilitating the insertion, folding, and assembly of proteins into the bacterial membrane. It plays an essential role in membrane protein biogenesis by acting as a membrane protein chaperone that assists in the proper insertion of various substrate proteins into the lipid bilayer.

The protein is a full-length 558 amino acid protein with characteristic membrane-spanning domains and functional regions that enable it to interact with nascent membrane proteins and assist their integration into the bacterial membrane . As a pathogenic bacterium that causes melioidosis, B. pseudomallei relies on properly functioning membrane proteins for virulence, survival, and antibiotic resistance, making YidC an important protein for bacterial physiology and potentially pathogenesis.

How is the recombinant B. pseudomallei YidC protein typically produced for research applications?

Recombinant B. pseudomallei YidC protein is typically produced using an E. coli expression system with an N-terminal His-tag for purification purposes. The full-length protein (amino acids 1-558) is expressed in E. coli, which provides a suitable bacterial environment for proper folding of this prokaryotic membrane protein .

The methodological approach involves:

  • Cloning the yidC gene from B. pseudomallei (gene ID: BPSL0078 or BURPS1710b_0304) into an appropriate expression vector

  • Transforming the construct into E. coli expression strains optimized for membrane protein production

  • Induction of protein expression under controlled conditions

  • Cell lysis and membrane fraction isolation

  • Solubilization of membrane proteins using appropriate detergents

  • Purification via immobilized metal affinity chromatography (IMAC) using the His-tag

  • Additional purification steps as needed (size exclusion chromatography, ion exchange)

  • Final preparation as a lyophilized powder in a stabilizing buffer containing 6% trehalose at pH 8.0

This production method yields protein with greater than 90% purity as determined by SDS-PAGE analysis.

What are the optimal storage and handling conditions for recombinant YidC protein to maintain its structural integrity?

To maintain the structural integrity and functional properties of recombinant B. pseudomallei YidC protein, researchers should follow these evidence-based storage and handling protocols:

  • Long-term storage: Store the lyophilized powder at -20°C to -80°C. The lyophilized form with 6% trehalose (pH 8.0) provides stability during freeze-storage .

  • Reconstitution process:

    • Briefly centrifuge the vial prior to opening to collect contents at the bottom

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (recommended 50%) for cryoprotection

    • Aliquot for long-term storage to avoid repeated freeze-thaw cycles

  • Working conditions:

    • For short-term use, store working aliquots at 4°C for up to one week

    • Avoid repeated freeze-thaw cycles as they significantly reduce protein activity

    • Maintain appropriate pH (around 8.0) during experimental procedures

  • Buffer considerations:

    • Tris/PBS-based buffers are compatible with functional studies

    • When changing buffers for specific applications, perform gradual dialysis to avoid protein destabilization

    • Consider including mild detergents for maintaining solubility of this membrane protein

Following these guidelines maximizes protein stability and ensures reliable experimental outcomes when working with this challenging membrane protein.

How can researchers effectively assess the functional activity of recombinant YidC in membrane protein insertion assays?

Researchers can assess the functional activity of recombinant YidC using in vitro translation/insertion assays with inverted membrane vesicles (INVs). This approach provides quantitative data on YidC's ability to facilitate protein insertion into membranes.

Methodological protocol:

  • INV preparation:

    • Prepare INVs from bacterial strains expressing recombinant YidC or control strains

    • Isolate bacterial membranes and create inside-out vesicles through physical disruption

    • Quantify protein content and standardize vesicle preparations

  • In vitro translation system:

    • Utilize a cell-free translation system (e.g., E. coli S30 extract)

    • Include radiolabeled amino acids for detection of newly synthesized proteins

    • Add appropriate mRNA encoding known YidC substrates such as:

      • Pf3 coat protein

      • M13 procoat H5

      • F0c subunit of ATP synthase

      • SecG protein or variants like SecG I20E

  • Insertion assay and detection:

    • Combine INVs with the translation mixture

    • Allow insertion reaction to proceed (typically 30-60 minutes at 37°C)

    • Assess insertion by proteinase K protection assay:

      • Treat samples with proteinase K to digest non-inserted portions

      • Analyze membrane-protected fragments (MPFs) by SDS-PAGE and autoradiography

      • Quantify protected fragments relative to total translated protein

  • Comparative analysis:

    • Compare insertion efficiency between YidC-enriched INVs and control INVs

    • Expect 1.5-1.8 fold stimulation of insertion for YidC substrates like Pf3 coat, M13 procoat H5, and F0c when YidC is functional

    • Include appropriate controls (e.g., INVs enriched with other proteins like YibN)

This functional assay allows researchers to determine if recombinant YidC maintains its native ability to facilitate membrane protein insertion, which is essential for confirming the biological activity of the purified protein.

What are the key protein-protein interactions of YidC, and how can these be experimentally investigated?

YidC engages in critical protein-protein interactions that facilitate its function in membrane protein biogenesis. Key interactions and experimental approaches to study them include:

Known interacting partners:

  • YibN: A bona fide interactor that stimulates protein insertion activity

  • Nascent membrane proteins: Various substrates that require YidC for insertion

  • Potentially SecYEG components: In bacteria where YidC cooperates with the Sec translocon

Experimental approaches to investigate these interactions:

  • Co-immunoprecipitation (Co-IP):

    • Use anti-His antibodies to pull down His-tagged YidC

    • Analyze co-precipitated proteins by mass spectrometry

    • Confirm specific interactions with reciprocal Co-IP experiments

  • Proximity-based labeling techniques:

    • BioID approach: Fuse YidC to a biotin ligase (BirA*)

    • Allow in vivo biotinylation of proximal proteins

    • Isolate biotinylated proteins using streptavidin affinity purification

    • Identify interaction partners by mass spectrometry

  • Crosslinking studies:

    • Use chemical crosslinkers or photo-crosslinking amino acids

    • Incorporate crosslinkers at specific positions within YidC

    • Identify crosslinked protein complexes by Western blot or mass spectrometry

  • In vitro binding assays:

    • Express and purify potential interaction partners

    • Perform direct binding assays using techniques such as:

      • Surface plasmon resonance (SPR)

      • Microscale thermophoresis (MST)

      • Isothermal titration calorimetry (ITC)

    • Quantify binding affinity and kinetics

  • Functional assays to verify interactions:

    • Compare protein insertion efficiency in the presence and absence of interaction partners

    • For example, test whether YibN enhances YidC-mediated insertion using INVs enriched for both proteins

    • Measure stimulation of insertion activity (e.g., 1.5-1.8 fold enhancement)

Researchers should consider combining multiple approaches to establish genuine interactions and distinguish them from non-specific associations that can occur with membrane proteins.

How can researchers differentiate between YidC-dependent and YidC-independent membrane protein insertion pathways?

Differentiating between YidC-dependent and YidC-independent membrane protein insertion pathways requires systematic experimental approaches that can isolate the specific contribution of YidC. Here's a comprehensive methodology:

  • Genetic approaches:

    • Create conditional YidC depletion strains (using regulatable promoters)

    • Generate YidC knockout strains complemented with plasmid-encoded YidC

    • Utilize YidC mutants with specific defects in substrate recognition or insertion function

    • Express potential substrate proteins in these genetic backgrounds to assess YidC dependency

  • In vitro reconstitution experiments:

    • Prepare proteoliposomes containing purified YidC or control liposomes without YidC

    • Add in vitro translated substrate proteins

    • Measure insertion efficiency through protease protection assays

    • Compare insertion rates between YidC-containing and YidC-free proteoliposomes

  • Substrate analysis techniques:

    • Examine specific substrate properties that determine YidC-dependency:

      • Charge distribution within transmembrane segments

      • Membrane topology

      • Presence of specific recognition motifs

    • Systematically alter these properties through mutagenesis

    • Test insertion efficiency of wild-type and mutant substrates

  • Comparative INV assays:

    • Prepare INVs from strains with:

      • Normal YidC levels

      • YidC depletion

      • YidC overexpression

      • YibN enrichment (as YibN stimulates YidC activity)

    • Test insertion of model substrates such as:

      • Pf3 coat protein (strongly YidC-dependent)

      • M13 procoat H5 (YidC-dependent)

      • F0c (YidC-dependent)

      • SecG and SecG I20E (differentially affected by YidC)

  • Quantitative assessment:

    • Calculate insertion efficiency ratios between YidC+ and YidC- conditions

    • Proteins showing >1.5-fold reduction in insertion efficiency upon YidC depletion likely represent YidC-dependent substrates

    • Proteins maintaining similar insertion efficiency regardless of YidC levels likely use YidC-independent pathways

This systematic approach allows researchers to classify membrane proteins based on their YidC dependency and elucidate the specific features that determine whether a protein requires YidC for proper membrane insertion.

How does B. pseudomallei YidC compare structurally and functionally to YidC homologs in other bacterial pathogens?

A comparative analysis of B. pseudomallei YidC with homologs from other bacterial pathogens reveals important structural and functional insights:

Structural comparison:

  • Sequence conservation:

    • B. pseudomallei YidC consists of 558 amino acids with characteristic membrane insertase domains

    • Sequence alignment with YidC homologs from other gram-negative pathogens shows conservation in:

      • Core transmembrane domains responsible for insertion activity

      • Cytoplasmic loops involved in substrate recognition

      • C-terminal region containing the catalytic site

  • Domain organization:

    • N-terminal periplasmic domain (varies in size across bacterial species)

    • Five transmembrane helices forming the hydrophobic core (highly conserved)

    • Cytoplasmic regions that interact with ribosomes and nascent chains

    • The periplasmic domain of B. pseudomallei YidC is larger than in some other bacteria, potentially affecting substrate specificity

  • Structural features unique to B. pseudomallei:

    • The amino acid sequence (provided in search results) shows species-specific variations in the periplasmic domain

    • These variations may influence substrate recognition and interaction with other membrane components

Functional comparison:

  • Conservation of core function:

    • YidC's fundamental role in membrane protein insertion is conserved across bacterial species

    • Both B. pseudomallei YidC and homologs from other pathogens facilitate:

      • Insertion of membrane proteins

      • Folding of transmembrane domains

      • Assembly of membrane protein complexes

  • Substrate specificity:

    • While core function is conserved, substrate specificity may differ

    • The unique periplasmic domain of B. pseudomallei YidC could influence which membrane proteins depend on it

    • Comparative studies with model substrates (Pf3 coat, M13 procoat) show similar but not identical insertion efficiency across bacterial species

  • Protein interactions:

    • YidC interaction with YibN represents an important functional relationship

    • The YidC-YibN interaction appears to stimulate protein insertion activity

    • Similar interactions with homologous proteins likely exist in other pathogens but may show species-specific variations

  • Role in pathogenesis:

    • In various pathogens, YidC is involved in membrane biogenesis essential for virulence

    • The specific contribution to virulence determinants may vary between B. pseudomallei and other bacterial species

    • Comparative virulence studies of YidC mutants across bacterial species would provide valuable insights

This comparative analysis highlights both the conservation of fundamental YidC function across bacterial species and the potential for species-specific adaptations in B. pseudomallei that may contribute to its unique pathogenicity and environmental persistence.

Could YidC represent a potential target for development of novel antimicrobials or vaccines against B. pseudomallei infection?

YidC represents a promising yet challenging target for antimicrobial and vaccine development against B. pseudomallei infections. Based on its biological role and the characteristics of successful B. pseudomallei immunotherapies, we can evaluate its potential:

As an antimicrobial target:

As a vaccine candidate:

While YidC presents theoretical advantages as a therapeutic target, experimental validation is needed. The successful immunoprotection demonstrated by other B. pseudomallei proteins like MprA provides a methodological framework for evaluating YidC's potential, though its membrane-embedded nature presents unique challenges compared to more exposed antigenic proteins.

What are effective strategies for performing site-directed mutagenesis studies on B. pseudomallei YidC to identify critical functional residues?

Conducting site-directed mutagenesis studies on B. pseudomallei YidC requires a systematic approach to identify critical functional residues while navigating the challenges of working with a membrane protein. Here is a comprehensive strategy:

Target selection for mutagenesis:

  • Sequence-based targeting:

    • Perform multiple sequence alignment of YidC across diverse bacterial species

    • Identify highly conserved residues as primary targets

    • Focus on the five transmembrane domains and periplasmic loops

    • Analyze the complete 558 amino acid sequence for functional motifs

  • Structure-informed targeting:

    • Use homology modeling based on resolved structures of YidC homologs

    • Identify residues in the hydrophobic core likely involved in substrate interaction

    • Target residues at the membrane interface and periplasmic regions

    • Focus on charged residues within transmembrane segments

  • Function-based targeting:

    • Select residues potentially involved in YibN interaction

    • Target the catalytic site based on homology to other insertases

    • Identify residues potentially involved in ribosome binding

Mutagenesis methodology:

  • Plasmid-based system:

    • Clone the B. pseudomallei yidC gene into a suitable expression vector with His-tag

    • Implement site-directed mutagenesis using:

      • QuikChange PCR-based mutagenesis

      • Gibson Assembly for multiple mutations

      • Golden Gate Assembly for systematic mutant libraries

  • Types of mutations to consider:

    • Conservative substitutions to assess specific chemical properties

    • Alanine scanning to identify essential side chains

    • Charge reversals to test electrostatic interactions

    • Cysteine substitutions for subsequent crosslinking studies

  • Expression and purification:

    • Express wildtype and mutant proteins in E. coli

    • Purify using established protocols for His-tagged proteins

    • Verify protein expression and purity by SDS-PAGE (>90% purity)

    • Assess proper folding through circular dichroism spectroscopy

Functional assessment of mutations:

  • In vitro translation/insertion assays:

    • Prepare INVs containing wildtype or mutant YidC

    • Compare insertion efficiency of model substrates:

      • Pf3 coat protein

      • M13 procoat H5

      • F0c subunit

      • SecG and variants like SecG I20E

    • Quantify relative activity (functional mutants should maintain 1.5-1.8 fold stimulation)

  • YibN interaction studies:

    • Test whether mutations affect stimulation by YibN

    • Perform binding assays between mutant YidC and YibN

    • Quantify changes in binding affinity or insertion stimulation

  • Complementation studies:

    • Develop a YidC depletion strain

    • Test ability of mutants to complement growth defects

    • Assess membrane protein composition in complemented strains

This systematic approach will generate a comprehensive map of functionally critical residues in B. pseudomallei YidC, providing insights into its mechanism of action and potentially identifying sites for therapeutic targeting.

How can researchers develop a reconstituted system to study B. pseudomallei YidC-mediated membrane protein insertion in a controlled environment?

Developing a reconstituted system for studying B. pseudomallei YidC-mediated membrane protein insertion provides researchers with precise control over experimental variables. Here's a comprehensive protocol for establishing such a system:

1. Purification of components:

  • YidC protein preparation:

    • Express recombinant His-tagged YidC in E. coli

    • Extract using gentle detergents (DDM, LDAO, or Digitonin)

    • Purify via IMAC using the His-tag

    • Further purify by size exclusion chromatography

    • Verify purity (>90%) by SDS-PAGE

    • Maintain in stabilizing buffer with 6% trehalose at pH 8.0

  • Substrate protein preparation:

    • Select established YidC substrates (Pf3 coat, M13 procoat, F0c, SecG)

    • Express with appropriate tags for detection

    • For co-translational insertion studies, prepare mRNA templates

  • Optional components:

    • Purify YibN, which stimulates YidC activity

    • Include ribosomes for co-translational studies

    • Prepare SecYEG for studying cooperative insertion pathways

2. Liposome preparation:

  • Lipid composition:

    • Use E. coli polar lipid extract as base composition

    • Adjust phospholipid ratios to mimic B. pseudomallei membranes

    • Include fluorescent-labeled lipids for visualization if needed

  • Liposome formation:

    • Dissolve lipids in chloroform and create thin film by evaporation

    • Hydrate with buffer to form multilamellar vesicles

    • Subject to freeze-thaw cycles for homogenization

    • Extrude through polycarbonate filters (100-200 nm) to create unilamellar vesicles

    • Verify size distribution by dynamic light scattering

3. Proteoliposome reconstitution:

  • Incorporation of YidC:

    • Mix purified YidC with preformed liposomes

    • Add detergent at sub-solubilizing concentration

    • Remove detergent using Bio-Beads or dialysis

    • Confirm incorporation by flotation assay

    • Determine protein-to-lipid ratio and orientation

  • Preparation of control liposomes:

    • Empty liposomes (protein-free)

    • Liposomes with inactive YidC mutants

    • Liposomes with YidC plus YibN (for stimulation studies)

4. Functional insertion assays:

  • Co-translational insertion:

    • Prepare cell-free translation system

    • Add mRNA encoding YidC substrate

    • Include proteoliposomes during translation

    • Measure insertion by protease protection assay

    • Compare YidC proteoliposomes vs. controls

  • Post-translational insertion:

    • Purify substrate proteins in mild detergent

    • Mix with proteoliposomes

    • Monitor insertion kinetics over time

    • Assess insertion by:

      • Protease protection assays

      • Fluorescence-based assays if using labeled substrates

      • Sucrose gradient fractionation

  • Quantitative analysis:

    • Calculate insertion efficiency (% protected fragments)

    • Determine insertion kinetics

    • Compare insertion rates between different proteoliposome preparations

    • Measure effects of YibN on insertion stimulation

5. Advanced applications:

  • Single-vesicle studies:

    • Use fluorescently labeled components

    • Perform total internal reflection fluorescence (TIRF) microscopy

    • Monitor insertion events at single-vesicle level

  • Structure-function studies:

    • Incorporate YidC mutants into proteoliposomes

    • Compare insertion efficiency to wild-type

    • Correlate functional defects with specific mutations

  • Biophysical characterization:

    • Monitor energetics of insertion using calorimetry

    • Examine conformational changes during insertion using FRET

    • Study interactions between YidC and substrates using crosslinking

This reconstituted system provides a powerful platform for dissecting the molecular mechanisms of YidC-mediated membrane protein insertion in a controlled environment, free from confounding cellular factors.

What approaches can be used to investigate the potential interactions between YidC and host immune response factors during B. pseudomallei infection?

Investigating interactions between B. pseudomallei YidC and host immune response factors requires integrating molecular, cellular, and immunological techniques. Here's a comprehensive research approach:

1. Immunological profiling:

  • Antibody response analysis:

    • Test sera from melioidosis patients for anti-YidC antibodies

    • Compare antibody titers between acute and convalescent samples

    • Characterize antibody isotypes (IgG, IgM, IgA) and subclasses

    • Develop ELISA assays using purified recombinant YidC

  • T-cell response assessment:

    • Identify potential T-cell epitopes in YidC using prediction algorithms

    • Test peripheral blood mononuclear cells (PBMCs) from patients for reactivity to YidC peptides

    • Analyze cytokine profiles (IFN-γ, IL-4, IL-17) to determine T-cell polarization

    • Compare to established immunogenic B. pseudomallei proteins like MprA

2. Cellular interaction studies:

  • Innate immune cell interactions:

    • Expose macrophages and dendritic cells to purified YidC

    • Measure activation markers (CD80, CD86, MHC-II)

    • Assess cytokine production (TNF-α, IL-1β, IL-6, IL-12)

    • Determine if YidC activates pattern recognition receptors (TLRs, NLRs)

  • Epithelial cell studies:

    • Investigate YidC effects on respiratory and skin epithelial cells

    • Measure inflammatory mediator production

    • Assess changes in barrier function and cell adhesion

3. Molecular interaction analysis:

  • Protein-protein interaction screening:

    • Perform yeast two-hybrid or bacterial two-hybrid screens against human immune proteins

    • Use co-immunoprecipitation with human immune cell lysates

    • Apply proximity labeling techniques (BioID) in infection models

    • Validate interactions using surface plasmon resonance or microscale thermophoresis

  • Host protein binding assays:

    • Test direct binding of YidC to purified human defense proteins

    • Screen for interactions with complement components

    • Examine binding to antimicrobial peptides

    • Investigate potential interactions with intracellular immune sensors

4. Infection model studies:

  • Cell culture infection models:

    • Compare immune responses to wild-type B. pseudomallei versus YidC-depleted strains

    • Assess differences in cytokine induction and immune cell activation

    • Measure bacterial survival in macrophages or neutrophils

    • Monitor effects on different colony morphotypes (types I, II, and III)

  • Mouse infection models:

    • Engineer strains with altered YidC expression or mutated YidC

    • Compare virulence and immune responses in BALB/c mice

    • Assess bacterial burden, cytokine profiles, and survival rates

    • Evaluate potential as a vaccine candidate similar to MprA studies

5. Comparative immunological studies:

  • YidC versus established immunogens:

    • Compare immune responses to YidC and MprA protease

    • Assess differences in antibody isotype profiles (e.g., IgG1 predominance with MprA)

    • Evaluate protective efficacy in challenge studies

    • Test combination approaches for enhanced protection

  • Structural immunology:

    • Map immunodominant epitopes on YidC structure

    • Determine accessibility of epitopes (periplasmic domains versus transmembrane regions)

    • Design epitope-focused immunogens based on accessible regions

This multifaceted approach would provide comprehensive insights into how YidC might interact with host immune factors during B. pseudomallei infection, potentially revealing its role in pathogenesis and its value as a therapeutic or vaccine target.

What are the most promising future research directions for studying B. pseudomallei YidC function and applications?

Based on current knowledge of B. pseudomallei YidC, several promising research directions emerge for advancing our understanding of its function and potential applications:

  • Comprehensive substrate identification:

    • Develop proteomic approaches to identify the complete set of B. pseudomallei membrane proteins dependent on YidC for insertion

    • Map the "YidC dependome" to understand its global role in membrane proteostasis

    • Connect YidC-dependent membrane proteins to specific virulence traits

  • Structural biology approaches:

    • Determine the high-resolution structure of B. pseudomallei YidC

    • Characterize conformational changes during the insertion process

    • Identify structural features unique to B. pseudomallei compared to other bacterial homologs

    • Use structural insights to guide rational drug design targeting YidC function

  • Pathogenesis mechanisms:

    • Create conditional YidC mutants in B. pseudomallei to study effects on virulence

    • Investigate YidC's role in colony morphotype switching, which affects virulence

    • Examine YidC contribution to antimicrobial resistance mechanisms

    • Study YidC's role in bacterial adaptation to different host environments

  • YidC-YibN interaction characterization:

    • Map the molecular interface between YidC and YibN

    • Determine the mechanism by which YibN stimulates YidC activity

    • Investigate whether this stimulation affects all or only specific YidC substrates

    • Explore potential for targeting this interaction therapeutically

  • Therapeutic development:

    • Screen for small molecule inhibitors of B. pseudomallei YidC

    • Evaluate accessible epitopes of YidC as vaccine candidates

    • Compare protective efficacy with established candidates like MprA

    • Develop combination approaches targeting multiple membrane biogenesis pathways

  • Advanced methodological developments:

    • Establish single-molecule techniques to study YidC-mediated insertion in real-time

    • Develop cell-free expression systems optimized for B. pseudomallei membrane proteins

    • Create reporter systems for monitoring YidC activity in living bacteria

    • Implement cryo-electron tomography to visualize YidC in native membrane environments

  • Comparative studies across bacterial species:

    • Compare functional differences between YidC homologs from different pathogens

    • Identify species-specific features that could be selectively targeted

    • Study conservation of the YidC-YibN relationship across bacterial species

    • Investigate functional redundancy or specialization among multiple YidC homologs

These research directions would significantly advance our understanding of B. pseudomallei membrane protein biogenesis, potentially leading to new therapeutic strategies for combating melioidosis, a disease with limited treatment options and high mortality rates.

What are the current limitations in YidC research, and how might they be addressed in future studies?

Current research on B. pseudomallei YidC faces several significant limitations that future studies should address:

Technical and methodological limitations:

  • Membrane protein challenges:

    • Difficulty in expressing and purifying sufficient quantities of stable YidC

    • Current protocols yield functional protein but with potential for optimization

    • Solution: Develop specialized expression systems with membrane protein chaperones; optimize detergent and lipid compositions for improved stability; explore nanodiscs and amphipols as alternatives to detergents

  • Structural determination hurdles:

    • Limited structural information on B. pseudomallei YidC specifically

    • Challenges in crystallizing membrane proteins

    • Solution: Apply cryo-EM for structure determination; use integrative structural biology combining multiple techniques (SAXS, NMR, crosslinking); leverage AlphaFold2 predictions with experimental validation

  • Reconstitution system limitations:

    • Current in vitro systems may not fully replicate the native membrane environment

    • Difficulty maintaining proper orientation in proteoliposomes

    • Solution: Develop more sophisticated membrane mimetics; incorporate native B. pseudomallei lipids; establish protocols for controlling YidC orientation

Knowledge gaps:

  • Incomplete substrate identification:

    • Limited knowledge of which B. pseudomallei proteins specifically require YidC

    • Uncertainty about substrate recognition features

    • Solution: Implement proteome-wide approaches including ribosome profiling during YidC depletion; develop computational prediction tools for YidC dependence

  • Regulatory mechanisms:

    • Poor understanding of how YidC expression and activity are regulated

    • Unknown factors controlling YidC-YibN interaction

    • Solution: Study transcriptional and post-translational regulation of YidC; examine environmental triggers that modulate YidC activity

  • Pathogenesis connection:

    • Unclear direct link between YidC function and B. pseudomallei virulence

    • Limited information on YidC's role in different infection stages

    • Solution: Develop conditional YidC mutants; examine YidC contribution to colony morphology switching ; study YidC requirement for specific virulence factor expression

Research context limitations:

  • Biosafety restrictions:

    • B. pseudomallei is a Tier 1 select agent requiring BSL-3 facilities

    • Limited number of laboratories can work directly with virulent strains

    • Solution: Develop attenuated strains for broader research use; establish surrogate systems in related but less pathogenic Burkholderia species

  • Comparative context:

    • Limited direct comparison with YidC from other pathogens

    • Incomplete understanding of unique features of B. pseudomallei YidC

    • Solution: Conduct systematic comparative studies across bacterial species; identify B. pseudomallei-specific features that could be therapeutic targets

  • Translational research gaps:

    • Limited exploration of YidC as a therapeutic target

    • Few studies on immunological properties compared to established immunogens like MprA

    • Solution: Screen for YidC inhibitors; evaluate immunogenicity in animal models; explore combination approaches with other targets

Future integrated approaches:

  • Systems biology integration:

    • Combine transcriptomics, proteomics, and metabolomics during YidC manipulation

    • Model the membrane proteome dynamics dependent on YidC

    • Connect YidC function to broader cellular networks

  • Advanced imaging techniques:

    • Apply super-resolution microscopy to visualize YidC localization and dynamics

    • Use cryo-electron tomography to examine YidC in native membrane environments

    • Implement single-molecule tracking to study YidC mobility and interactions

  • Interdisciplinary collaboration:

    • Combine expertise in structural biology, membrane biochemistry, microbial pathogenesis, and immunology

    • Develop shared resources and standardized protocols for YidC research

    • Establish consortia focused on membrane protein biogenesis in bacterial pathogens

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.