Recombinant Burkholderia pseudomallei Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
mtgA; BPSL2975; Biosynthetic peptidoglycan transglycosylase; Glycan polymerase; Peptidoglycan glycosyltransferase MtgA; PGT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-256
Protein Length
full length protein
Species
Burkholderia pseudomallei (strain K96243)
Target Names
mtgA
Target Protein Sequence
MRNSPVSPGPGYAPARGSERARRRGVARWLAYVGGVFAGAWLATQLYYAVQIAMWSVFDP GSSAFMRADAWRLSNAQPATTIRHRWVPYDQIARTLKRAVIASEDADFANNSGYEVDAIL QAWEKNRARGRIVSGGSTITQQLARNLFLSGERSYIRKGQELIITWMLETLLDKERIFEI YLNSVEFGRGVYGAQAAAQYYYRIPASRLSAWQSARLAVMLPNPKYFDAHRGSPYLAQRA GVIARRMGAAELPASQ
Uniprot No.

Target Background

Function
A peptidoglycan polymerase that catalyzes the elongation of glycan chains from lipid-linked precursors.
Database Links
Protein Families
Glycosyltransferase 51 family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What genetic approaches can be used to study mtgA function in B. pseudomallei given its select agent status?

Studying mtgA in B. pseudomallei requires specialized approaches due to its classification as a select agent in the United States with strict regulatory oversight. Researchers can employ the following methodological strategies:

  • Markerless allele replacement: Using systems such as the mobilizable vector pEXKm5, which contains a multiple cloning site within a lacZα gene for facile cloning and a constitutively expressed gusA indicator gene for visual detection of genetic manipulations .

  • I-SceI homing endonuclease-based recombination: This approach utilizes pBADSce, which contains an araC-PBAD-IsceI expression cassette for arabinose-inducible I-SceI expression to resolve merodiploids .

  • sacB-based counterselection: An alternative resolution method that can be employed with the pEXKm5 vector system for creating precise genetic modifications .

The table below outlines the key components of the genetic manipulation system applicable to mtgA studies:

ComponentFunctionApplication to mtgA Research
pEXKm5 vectorContains MCS in lacZα gene; gusA indicator geneCloning mtgA for manipulation or expression
pBADScearaC-PBAD-IsceI expression cassetteResolution of merodiploids in mtgA modification
sacB systemCounterselection markerAlternative merodiploid resolution method
gusAVisual detection of genetic eventsIdentification of successful mtgA recombinants

These tools enable researchers to create mtgA knockouts, point mutations, or tagged versions for functional studies while complying with select agent regulations.

How can researchers optimize expression of recombinant B. pseudomallei mtgA in laboratory settings?

Optimizing expression of recombinant B. pseudomallei mtgA requires careful consideration of multiple experimental parameters. Based on approaches used with other B. pseudomallei proteins, researchers should consider:

  • Expression system selection: While homologous expression in B. pseudomallei provides the most native conditions, heterologous expression in E. coli or the closely related but non-select agent B. thailandensis may offer practical advantages for preliminary studies.

  • Environmental conditions: Culture conditions significantly impact protein expression in Burkholderia species. For instance, research has shown that "when cultured in a more acidic pH of 4.5, B. thailandensis secretes increased amounts of BipD as well as BopE" , suggesting pH adjustment as a potential strategy for optimizing recombinant protein production.

  • Induction systems: The arabinose-inducible promoter system (PBAD) used in pBADSce for I-SceI expression represents a tightly regulated expression system that could be adapted for mtgA.

The following table presents a methodological approach for optimizing mtgA expression:

ParameterExperimental ConditionsAssessment Method
Temperature25°C, 30°C, 37°CWestern blot quantification
pH6.0, 6.8, 7.4, 8.0Protein yield determination
Media compositionLB, BHI, M9 minimal mediaSDS-PAGE analysis
Induction timingEarly-log, mid-log, late-log phaseActivity assays
Inducer concentration0.1%, 0.2%, 0.5% arabinoseSolubility assessment

Success with recombinant mtgA expression would require systematic evaluation of these parameters, with optimization decisions based on both protein yield and enzymatic activity measurements.

What are the challenges in purifying active recombinant mtgA and how can they be addressed?

Purifying active recombinant mtgA from B. pseudomallei presents several technical challenges that require methodological solutions:

  • Membrane association: As a transglycosylase involved in cell wall synthesis, mtgA likely contains hydrophobic regions that associate with the cytoplasmic membrane. Extraction requires careful selection of detergents that solubilize the protein without denaturing it.

  • Maintaining enzymatic activity: Transglycosylases often require specific cofactors or environmental conditions to maintain activity during purification. Buffer optimization with stabilizing agents is essential.

  • Biosafety considerations: Working with B. pseudomallei requires containment facilities. Alternative approaches include expressing the protein in non-pathogenic hosts or developing cell-free expression systems.

  • Substrate availability: Functional characterization requires access to lipid II substrates, which are not commercially available and must be synthesized or isolated.

A systematic purification strategy might involve:

Purification StageMethodCritical Parameters
Cell lysisMechanical disruption with detergentDetergent type (DDM, CHAPS), concentration, temperature
Initial captureImmobilized metal affinity chromatographyImidazole concentration, flow rate, pH
Secondary purificationIon exchange chromatographySalt gradient, buffer composition
Final polishingSize exclusion chromatographyFlow rate, buffer composition
Activity preservationAddition of stabilizing agentsGlycerol percentage, reducing agents, specific lipids

The genetic tools described for B. pseudomallei could be adapted to create tagged versions of mtgA for affinity purification, facilitating the initial capture step in this process.

How can researchers assess the enzymatic activity of recombinant mtgA?

Assessing mtgA enzymatic activity requires specialized approaches suitable for transglycosylases. Researchers can employ several complementary methods:

  • Radiolabeled substrate assays: Using lipid II precursors labeled with radioactive isotopes to track polymerization activity.

  • Fluorescence-based assays: Employing fluorescently labeled lipid II analogs whose polymerization causes detectable changes in fluorescence intensity or anisotropy.

  • HPLC/mass spectrometry: Analyzing reaction products to determine the length and composition of synthesized glycan strands.

  • Complementation studies: Testing whether recombinant mtgA can restore normal phenotypes in conditional mutants, similar to approaches used with other B. pseudomallei virulence factors where "both phenotypes could be complemented by expression of chbP in trans" .

  • Antibiotic susceptibility testing: Assessing changes in sensitivity to cell wall-targeting antibiotics in strains with modified mtgA expression.

The table below outlines key parameters for a typical mtgA activity assay:

Assay ComponentConcentration/ConditionConsideration
Lipid II substrate10-50 μMLimited availability, may require synthesis
Reaction bufferpH 7.5, 10 mM MgCl₂Optimize for maximum activity
Temperature30°CBalance between activity and stability
Detergent0.02-0.1% DDMRequired for solubility but may inhibit at high concentrations
Reaction time30-120 minutesMonitor time course to determine linear range
Detection methodFluorescence or HPLCSensitivity vs. information content trade-off

By systematically optimizing these parameters, researchers can develop robust assays for characterizing mtgA from B. pseudomallei.

What structural and functional differences exist between mtgA from B. pseudomallei and related enzymes from other bacterial pathogens?

Comparative analysis of B. pseudomallei mtgA with homologs from other bacteria reveals important structural and functional distinctions that may influence therapeutic targeting. While specific structural data on B. pseudomallei mtgA is limited, analysis based on homology modeling and sequence comparison would reveal key differences:

  • Catalytic domain architecture: Variations in the active site residues that may affect substrate specificity or catalytic efficiency.

  • Membrane association domains: Differences in transmembrane or membrane-interacting regions that influence subcellular localization and activity regulation.

  • Protein-protein interaction motifs: Unique regions that mediate interactions with other cell wall synthesis enzymes or regulatory proteins.

The table below presents a hypothetical comparative analysis of key features across bacterial transglycosylases:

FeatureB. pseudomallei mtgAE. coli mtgAPseudomonas aeruginosa mtgAFunctional Implication
Active site motifsModified E-X-X-K motifCanonical E-X-X-KCanonical E-X-X-KPotential altered substrate specificity
Membrane anchoringSingle N-terminal TM domainSingle N-terminal TM domainExtended membrane association regionDifferences in localization
Regulatory domainsC-terminal extensionAbsentPresentSpecies-specific regulation
pH optimumPredicted acidic (pH 6.0-6.5)Neutral (pH 7.0-7.5)Slightly alkaline (pH 7.5-8.0)Adaptation to environmental niches

These differences could be experimentally verified using recombinant proteins and complementation studies across species, utilizing the genetic tools described for B. pseudomallei manipulation .

How does environmental pH affect mtgA expression and activity in B. pseudomallei, and what are the implications for intracellular survival?

The influence of pH on mtgA expression and activity represents an important aspect of B. pseudomallei adaptation during infection. While specific data on mtgA is not available in the search results, related findings provide methodological insights:

  • Differential protein expression: Research has shown that "when cultured in a more acidic pH of 4.5, B. thailandensis secretes increased amounts of BipD as well as BopE" . Similar pH-dependent regulation might occur with mtgA, particularly as B. pseudomallei encounters varying pH environments during infection (phagosomal acidification, cytosolic residence).

  • Structural pH dependence: Studies on the T3SS tip protein BipD demonstrated that "the structure of BipD, as well as IpaD and SipD, is dependent on pH changes" . Transglycosylases may similarly undergo pH-dependent conformational changes affecting activity.

  • Infection relevance: As B. pseudomallei transitions between extracellular environments, acidified phagosomes, and the neutral cytosol during infection, pH-responsive regulation of cell wall synthesis enzymes would be advantageous.

To investigate this relationship experimentally, researchers could examine:

pH ConditionExperimental ApproachMeasurements
pH 4.5 (phagosomal)Growth in pH-controlled mediamtgA transcription (qRT-PCR), protein levels (Western blot)
pH 7.0 (cytosolic)Intracellular bacterial isolationEnzymatic activity assays with purified protein
pH 7.4 (extracellular)pH-shift experimentsCell wall composition analysis
Dynamic pH changesMicrofluidic pH gradient exposureTime-course of adaptation response

These studies would reveal how B. pseudomallei modulates mtgA activity to maintain cell wall integrity across diverse host environments.

How can researchers develop and validate inhibitors targeting B. pseudomallei mtgA as potential therapeutics?

Developing inhibitors of B. pseudomallei mtgA as potential therapeutics requires a systematic approach spanning target validation to lead optimization. The methodological framework should include:

  • Target essentiality confirmation: Using the genetic tools described in search result , researchers can create conditional mtgA mutants to determine whether the enzyme is essential for viability or virulence, similar to studies with T3SS components where mutants demonstrated "attenuation in BALB/c mice" .

  • Assay development: Creating robust biochemical and cell-based assays to screen for inhibitors, incorporating knowledge about enzyme activity optimization.

  • Screening strategies: Employing virtual screening, fragment-based approaches, and high-throughput biochemical assays to identify initial hits.

  • Structure-activity relationship studies: Optimizing lead compounds for potency, selectivity, and drug-like properties.

  • Efficacy testing: Evaluating promising compounds in cellular and animal models of melioidosis.

The table below outlines a tiered approach to identifying and validating mtgA inhibitors:

Development StageMethodological ApproachSuccess Criteria
Primary screeningFluorescence-based TG assay with recombinant mtgA>50% inhibition at 10 μM
Secondary validationCell wall precursor accumulation analysisDose-dependent lipid II accumulation
Cellular activityGrowth inhibition of B. pseudomalleiMIC <10 μg/mL
Specificity assessmentCounterscreening against human enzymes>100-fold selectivity
Intracellular efficacyInfected macrophage model>2-log reduction in bacterial load
In vivo efficacyBALB/c mouse model of melioidosisSignificant survival improvement
Resistance developmentSerial passage studiesNo resistance after 20 passages

This approach would leverage understanding of B. pseudomallei pathogenesis and take advantage of the genetic tools available for this select agent pathogen to develop targeted antimicrobial strategies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.