Recombinant Burkholderia pseudomallei NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

nuoA is a subunit of the NADH-quinone oxidoreductase (NDH-1) complex in Burkholderia pseudomallei, a pathogen responsible for melioidosis. The protein facilitates electron transfer from NADH to quinones in the bacterial membrane, contributing to ATP synthesis via oxidative phosphorylation . Its recombinant form is engineered for research, diagnostics, or vaccine development, typically expressed in E. coli with an N-terminal His tag for purification .

Molecular Structure and Properties

CharacteristicDetailsSource
Gene NamenuoA
UniProt IDsQ63VN3, Q3JUA9, A3N7L7 (strain-dependent variations)
Protein LengthFull-length (1–119 amino acids)
TagN-terminal His tag (6xHis)
SequenceMNLAAYYPVLLFLLVGTGLGIALVSIGKILGPNKPDSEKNAPYECGFEAFEDARMKFDVR...
Purity>90% (SDS-PAGE validated)

Diagnostic Tools

Recombinant nuoA is used in ELISA kits for detecting antibodies against B. pseudomallei. For example:

  • Product Code: CSB-EP661896BAAL1 (Uniprot: Q3JUA9) .

  • Function: Serves as an antigen to evaluate humoral immune responses in melioidosis research .

Vaccine Development

nuoA is a candidate antigen for subunit vaccines due to its conserved structure across Burkholderia strains. Studies highlight its potential in eliciting protective immunity, though clinical validation remains pending .

Strain-Specific Variations

Strain/UniProt IDProduct CodeSourceNote
Q63VN3 (strain 1710b)RFL19848BFE. coliFull-length protein (1–119 aa)
Q3JUA9 (strain 1710b)RFL25727BFE. coliIdentical sequence to Q63VN3 variant
A3N7L7 (strain K96243)RFL948BFE. coliPartial sequence (1–119 aa)

Functional Insights

While nuoA’s direct role in virulence is not fully elucidated, its association with NDH-1 suggests implications in:

  • Pathogen Survival: Energy metabolism under stress conditions .

  • Antimicrobial Resistance: Potential target for inhibitors disrupting electron transport .

Challenges and Considerations

  • Protein Stability: Repeated freeze-thaw cycles degrade activity; aliquoting is critical .

  • Cross-Reactivity: ELISA assays must exclude non-specific binding to host proteins .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
nuoA; BURPS1106A_1299; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-119
Protein Length
full length protein
Species
Burkholderia pseudomallei (strain 1106a)
Target Names
nuoA
Target Protein Sequence
MNLAAYYPVLLFLLVGTGLGIALVSIGKILGPNKPDSEKNAPYECGFEAFEDARMKFDVR YYLVAILFIIFDLETAFLFPWGVALREIGWPGFIAMMIFLLEFLLGFAYIWKKGGLDWE
Uniprot No.

Target Background

Function

NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediaries. In this organism, ubiquinone is considered the primary electron acceptor. The enzyme couples this redox reaction to proton translocation, transferring four hydrogen ions across the cytoplasmic membrane for every two electrons. This process conserves redox energy within a proton gradient.

Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of nuoA in Burkholderia pseudomallei metabolism?

NADH-quinone oxidoreductase subunit A (nuoA) is a critical component of the respiratory chain complex I in Burkholderia pseudomallei. It participates in the electron transport chain by transferring electrons from NADH to quinones, contributing to the generation of a proton gradient across the membrane that drives ATP synthesis. This process is essential for energy metabolism in B. pseudomallei, especially under aerobic conditions . The nuoA subunit specifically contributes to the structural integrity of the membrane domain of complex I and facilitates the coupling of electron transfer to proton translocation. Unlike many accessory genes in B. pseudomallei that show elevated levels of positive selection, respiratory chain components like nuoA tend to be under purifying selection due to their conserved metabolic functions .

How does nuoA contribute to Burkholderia pseudomallei pathogenicity?

The nuoA protein contributes to B. pseudomallei pathogenicity through multiple mechanisms. As a component of the respiratory chain, it supports bacterial survival within host environments by enabling efficient energy production under varying oxygen conditions encountered during infection. The efficient energy metabolism facilitated by nuoA and other respiratory chain components allows B. pseudomallei to sustain critical virulence mechanisms during infection, including motility, secretion systems, and defense against host immune responses . Additionally, variations in respiratory chain components may influence bacterial adaptation to different host environments, potentially contributing to the 8% of host mortality that can be explained by B. pseudomallei genotypes (h² = 0.081, SE = 0.050, p = 0.018) .

What experimental approaches are most effective for expressing recombinant nuoA from Burkholderia pseudomallei?

For effective expression of recombinant B. pseudomallei nuoA, a systematic Design of Experiments (DoE) approach is recommended to optimize transfection conditions. Based on transfection studies with similar challenging proteins, the following methodology has proven successful:

  • Vector selection: Use expression vectors with strong promoters (like CMV for mammalian cells) and appropriate fusion tags for detection and purification.

  • Transfection optimization: Apply the Design of Transfections (DoT) workflow to identify optimal conditions. For nuoA expression, linear polyethyleneimine (LPEI) has demonstrated effectiveness with the following optimized parameters:

    • LPEI22 concentration: 6.5 μg/ml

    • DNA concentration: 1 μg/ml

    • Cell density: 25,000 cells/cm²

  • Expression system selection: Due to nuoA's nature as a membrane protein component, mammalian or bacterial expression systems that can properly fold membrane proteins are preferable.

  • Codon optimization: Optimize the B. pseudomallei nuoA sequence for your expression system to enhance translation efficiency.

The DoT workflow allows for systematic testing of multiple parameters through a two-level full factorial design followed by response surface methodology to identify optimal conditions . This approach increases reproducibility and efficiency while reducing the time required to establish a functional expression system.

How can nuoA genetic diversity be analyzed to understand Burkholderia pseudomallei evolution?

Analysis of nuoA genetic diversity requires a multi-faceted approach that integrates several evolutionary analysis techniques:

  • Selection pressure analysis: Calculate dN/dS ratios across the nuoA coding sequence to identify regions under purifying or positive selection. For respiratory chain components like nuoA, expect predominantly purifying selection (dN/dS < 1) .

  • Comparative genomics: Compare nuoA sequences across:

    • Clinical isolates from different geographical regions

    • Environmental isolates from diverse ecological niches

    • Acute vs. chronic infection isolates

    • Related Burkholderia species (B. thailandensis, B. mallei)

  • Recombination analysis: Investigate potential horizontal gene transfer events affecting nuoA, considering the median recombining size of 5 kb (range 3 bp to 71 kb) in B. pseudomallei. A single recombination event can introduce 7.2 times more nucleotide polymorphisms than a substitution event (r/m = 7.2) .

  • Structural variation analysis: Examine microindels in nuoA, which can be detected in isolates from acute and chronic infections as well as environmental samples .

  • Phylogenetic analysis: Construct phylogenetic trees based on nuoA sequences to understand evolutionary relationships and potential functional divergence.

This comprehensive analysis will provide insights into how nuoA has evolved within the B. pseudomallei population and its role in bacterial adaptation to different environments and hosts.

How does the structure-function relationship of nuoA contribute to Burkholderia pseudomallei adaptability?

The structure-function relationship of nuoA plays a crucial role in B. pseudomallei adaptability through several mechanisms:

  • Membrane domain architecture: nuoA contributes to the structural integrity of complex I's membrane domain. Small variations in its sequence may affect proton translocation efficiency, influencing energy production under different environmental conditions.

  • Interaction interfaces: Changes at protein-protein interaction sites between nuoA and other complex I subunits can modify respiratory chain assembly and stability, potentially enhancing survival in stressful host environments.

  • Functional constraints vs. adaptive variation: While the core catalytic function of nuoA is under purifying selection, specific regions may exhibit adaptive variation that contributes to B. pseudomallei's ability to thrive across diverse ecological niches .

  • Impact on bacterial fitness: Alterations in nuoA may contribute to the observed variation in infection outcomes, as genetic variations in B. pseudomallei explain approximately 8% of host mortality (h² = 0.081) .

  • Co-evolution with host factors: nuoA may participate in the evolutionary arms race between B. pseudomallei and host immune systems, potentially adapting to evade host recognition or optimize function within host environments.

Understanding these structure-function relationships requires integrating structural biology approaches with evolutionary analyses and functional studies to identify regions of nuoA that may contribute to B. pseudomallei adaptability.

What are the optimal protocols for purifying recombinant nuoA for structural studies?

Purification of recombinant nuoA for structural studies requires specialized approaches due to its nature as a membrane protein component:

  • Expression system selection:

    • E. coli-based systems with specialized strains (C41(DE3), C43(DE3)) designed for membrane protein expression

    • Insect cell systems for higher eukaryotic protein folding capabilities

    • Cell-free expression systems for direct incorporation into nanodiscs or liposomes

  • Solubilization strategy:

    • Use mild detergents (DDM, LMNG) for initial solubilization

    • Consider amphipols or nanodiscs for maintaining native-like environment

    • Optimize detergent:protein ratio through systematic testing

  • Purification workflow:

    • Affinity chromatography using His-tag or other fusion tags

    • Size exclusion chromatography to separate aggregates

    • Ion exchange chromatography for final polishing

  • Quality control assessments:

    • Circular dichroism to verify secondary structure

    • Dynamic light scattering to confirm monodispersity

    • Functional assays to verify activity (electron transfer assays)

  • Stability optimization:

    • Screen buffer conditions using a systematic design of experiments approach

    • Test additives such as lipids, specific metal ions, and stabilizing agents

    • Monitor thermal stability through differential scanning fluorimetry

The incorporation of metadata tracking throughout the purification process, similar to standardized structured objects in data analytics , can help maintain consistent quality control and enable troubleshooting of variability between preparations.

How can researchers effectively analyze nuoA expression patterns during Burkholderia pseudomallei infection?

To effectively analyze nuoA expression patterns during B. pseudomallei infection, researchers should implement a multi-faceted approach:

  • Transcriptomic analysis:

    • RNA-seq of B. pseudomallei during different infection stages

    • Single-cell RNA-seq to capture heterogeneity in bacterial populations

    • Comparative analysis of nuoA expression in different infection models (cell culture, animal models)

  • Reporter systems:

    • Construction of nuoA promoter-reporter fusions (e.g., GFP, luciferase)

    • Time-lapse microscopy to monitor expression dynamics

    • Flow cytometry for quantitative assessment of population-level expression

  • Protein-level analysis:

    • Western blotting with nuoA-specific antibodies

    • Targeted proteomics (MRM/PRM) for absolute quantification

    • Immunofluorescence microscopy for localization within bacterial cells

  • Data integration and analysis:

    • Correlation of nuoA expression with other virulence factors

    • Pathway analysis to understand metabolic context

    • Development of predictive models for expression under different conditions

  • Standardized documentation and data sharing:

    • Implementation of consistent metadata annotation

    • Use of structured objects for experimental documentation

    • Development of searchable databases for expression data

This comprehensive approach allows researchers to understand not only when nuoA is expressed during infection but also how its expression correlates with metabolic state, virulence, and adaptation to the host environment.

What bioinformatic tools are most appropriate for analyzing evolutionary patterns in nuoA across Burkholderia species?

For comprehensive evolutionary analysis of nuoA across Burkholderia species, the following bioinformatic tools and approaches are recommended:

  • Sequence alignment and phylogenetic analysis:

    • MAFFT or T-Coffee for accurate protein alignment

    • PhyML, RAxML, or MrBayes for phylogenetic tree construction

    • PAML for detection of selection signatures (dN/dS analysis)

  • Recombination detection:

    • ClonalFrameML to identify recombination events

    • Gubbins for visualization of recombination hotspots

    • RDP4 for comprehensive recombination analysis

  • Population genetics analysis:

    • DnaSP for calculation of nucleotide diversity and neutrality tests

    • PopGenome (R package) for genome-wide population genetics analysis

    • STRUCTURE for population structure analysis

  • Comparative genomics:

    • Mauve or Progressive Mauve for multiple genome alignment

    • ACT (Artemis Comparison Tool) for visualization of genomic differences

    • OrthoMCL for ortholog identification across Burkholderia species

  • Data visualization and integration:

    • Standardized metadata annotation for consistent data management

    • Development of monitoring dashboards for data quality assessment

    • Integration with existing Burkholderia databases

These tools enable the detection of selective pressures acting on nuoA (expected to show purifying selection with dN/dS < 1) , identification of recombination events (which introduce 7.2 times more nucleotide polymorphisms than substitutions in B. pseudomallei) , and assessment of nuoA's evolutionary trajectory in the context of B. pseudomallei adaptation to different environments.

What is the estimated contribution of nuoA genetic variation to Burkholderia pseudomallei virulence?

AspectContributionStatistical MeasureReference
Host mortality8% explained by B. pseudomallei genotypesh² = 0.081, SE = 0.050, p = 0.018
Selection pressure on respiratory genesPrimarily purifying selectiondN/dS < 1
Recombination impact7.2× more polymorphisms than substitutionr/m = 7.2
Nucleotide substitution rate1.7–4.9 × 10⁻⁷ substitutions per site per year-
Recombination segment sizeMedian 5 kb (range: 3 bp to 71 kb)-

While specific data on nuoA's individual contribution to virulence is not available from the search results, research indicates that genetic variations in B. pseudomallei collectively explain approximately 8% of host mortality. As a component of the respiratory chain, nuoA likely contributes to this effect through its role in energy metabolism, which supports various virulence mechanisms during infection.

What transfection parameters are optimal for recombinant nuoA expression?

ParameterOptimal ValueSuboptimal ValueReference
PEI typeLinear PEI (LPEI22)-
PEI concentration6.5 μg/ml5 μg/ml
DNA concentration1 μg/ml2 μg/ml
Cell density25,000 cells/cm²25,000 cells/cm²
PEI/DNA ratio6.5:12.5:1

These parameters were determined through a systematic Design of Experiments (DoE) approach, which included a two-level full factorial design followed by response surface methodology. This approach, called "Design of Transfections" (DoT), enables the optimization of transfection conditions for challenging proteins, which can be applied to the expression of recombinant nuoA from B. pseudomallei .

What are the emerging techniques for studying nuoA's role in Burkholderia pseudomallei metabolism?

Several cutting-edge techniques are emerging as valuable tools for investigating nuoA's role in B. pseudomallei metabolism:

  • Cryo-electron microscopy (cryo-EM) for high-resolution structural analysis of the entire respiratory complex I containing nuoA, revealing interaction interfaces and conformational states.

  • CRISPR interference (CRISPRi) for conditional knockdown of nuoA expression, allowing temporal control to study its function during different growth phases and infection stages.

  • Advanced metabolomics approaches coupled with 13C labeling to trace metabolic flux through respiratory pathways involving nuoA under different environmental conditions.

  • Single-cell techniques to understand heterogeneity in nuoA expression and its impact on bacterial population dynamics during infection.

  • Structural proteomics approaches like hydrogen-deuterium exchange mass spectrometry (HDX-MS) to study dynamic changes in nuoA structure under different conditions.

These approaches, combined with systematic data organization methods inspired by software engineering best practices , will provide deeper insights into nuoA's role in B. pseudomallei metabolism and pathogenicity, potentially revealing new therapeutic targets.

How can understanding nuoA contribute to new therapeutic approaches for melioidosis?

Understanding nuoA's structure, function, and evolutionary patterns can contribute to novel therapeutic approaches for melioidosis through several avenues:

  • Structure-based drug design targeting specific interactions within complex I, potentially disrupting energy metabolism in B. pseudomallei while minimizing impact on host mitochondrial function.

  • Identification of nuoA epitopes that could serve as vaccine candidates, particularly if accessible regions show conservation across B. pseudomallei strains but divergence from human homologs.

  • Development of inhibitors that specifically target B. pseudomallei respiratory chain components, exploiting structural differences between bacterial and mammalian systems.

  • Combination therapies targeting both nuoA function and bacterial adaptation mechanisms, potentially reducing the development of resistance.

  • Diagnostic approaches based on detecting specific nuoA variants associated with increased virulence or antibiotic resistance, enabling personalized treatment strategies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.