Recombinant Burkholderia pseudomallei NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Recombinant Expression and Purification

Recombinant nuoK is produced in Escherichia coli systems, typically fused with affinity tags (e.g., His-tag) for purification . Key production details include:

ParameterSpecification
Expression SystemE. coli
TagN-terminal His-tag (varies by product)
Storage BufferTris-based buffer with 50% glycerol
StabilityStable at -20°C; repeated freeze-thaw cycles not recommended
Purity>90% (SDS-PAGE verified)
Endotoxin LevelsAvailable as low-endotoxin upon request

Functional Role in B. pseudomallei Physiology

nuoK is essential for anaerobic respiration, enabling B. pseudomallei to survive in low-oxygen environments such as host tissues . Key findings:

  • Electron Transport: Transfers electrons from NADH to ubiquinone via FMN and iron-sulfur centers, translocating 4 H⁺ ions per 2 electrons .

  • Anaerobic Growth: Critical for nitrate respiration; deletion of narG (a related nitrate reductase gene) reduces anaerobic growth by >90% .

  • Pathogen Survival: Required for biofilm formation, motility, and persister cell development under stress .

Research Use

  • ELISA Development: Commercial kits (e.g., CBM15) utilize recombinant nuoK for antibody detection in melioidosis research .

  • Structural Studies: AlphaFold 2 predictions (UniProt Q63VM3) model nuoK’s transmembrane helices and interaction sites .

Therapeutic Targets

While not directly targeted in current therapies, nuoK’s role in redox biology makes it a candidate for antimicrobial drug design . Disruption of related DSB proteins (e.g., DsbA/DsbB) attenuates virulence in murine models .

Evolutionary and Genomic Insights

  • Conservation: nuoK is part of the core genome in Burkholderia spp., with orthologs identified in 427 bacterial genera .

  • Mutation Rate: B. pseudomallei exhibits a substitution rate of 1.7–4.9 × 10⁻⁷ per site/year, influencing adaptive evolution in hostile environments .

Challenges and Future Directions

  • Functional Redundancy: Multiple nitrate reductases (e.g., NarGHI) complicate targeted inhibition .

  • Diagnostic Potential: Cross-reactivity with antibodies against other Burkholderia species requires validation .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate special requests. Please specify your preferred format when placing your order and we will fulfill your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframe.
Note: All proteins are shipped with standard blue ice packs by default. For dry ice shipping, please contact us in advance to arrange the necessary logistics and associated fees.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, it is advisable to briefly centrifuge the vial to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors including storage conditions, buffer composition, temperature, and inherent protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us and we will prioritize its development.
Synonyms
nuoK; BURPS1106A_1309; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Burkholderia pseudomallei (strain 1106a)
Target Names
nuoK
Target Protein Sequence
MLTLAHYLVLGAILFAIAIVGIFLNRRNIIIILMAIELMLLAVNTNFVAFSHYLGDVHGQ IFVFFVLTVAAAEAAIGLAILVTLFRKLDTINVEDLDQLKG
Uniprot No.

Target Background

Function
NDH-1 facilitates the transfer of electrons from NADH, through FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this species, ubiquinone is considered the immediate electron acceptor for the enzyme. The enzyme couples the redox reaction with proton translocation (four hydrogen ions are translocated across the cytoplasmic membrane for every two electrons transferred), effectively conserving the redox energy as a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does the recombinant B. pseudomallei nuoK protein differ from its native form, and what considerations should researchers account for when using the recombinant version?

The recombinant B. pseudomallei nuoK protein differs from its native form primarily through the addition of an N-terminal His-tag, which facilitates purification but may alter certain structural and functional properties . The recombinant protein is expressed in E. coli, which means post-translational modifications may differ from those in the native B. pseudomallei environment .

When working with the recombinant version, researchers should consider:

  • Protein folding verification: Confirm proper folding using circular dichroism or limited proteolysis

  • Tag interference assessment: Evaluate whether the His-tag affects functional assays through comparative studies with tag-cleaved versions

  • Membrane reconstitution parameters: Optimize lipid composition to mimic the native bacterial membrane environment

  • Storage stability: The protein requires storage at -20°C/-80°C with proper aliquoting to avoid repeated freeze-thaw cycles

  • Reconstitution protocol: Follow specific reconstitution in deionized sterile water to 0.1-1.0 mg/mL with 5-50% glycerol for optimal stability

The reconstitution buffer composition is particularly critical, as improper pH or salt concentration can significantly impact protein stability and activity in experimental systems.

What are the optimal conditions for expressing and purifying recombinant B. pseudomallei nuoK protein, and how can researchers troubleshoot common purification challenges?

The optimal conditions for expressing and purifying recombinant B. pseudomallei nuoK involve a carefully controlled process:

Expression System:

  • Host: E. coli (BL21 or similar strains optimized for membrane protein expression)

  • Vector: pET or similar with N-terminal His-tag

  • Induction: 0.5-1.0 mM IPTG at OD600 of 0.6-0.8

  • Temperature: 16-18°C post-induction for 16-20 hours (reduces inclusion body formation)

Purification Protocol:

  • Cell lysis: Sonication or pressure-based disruption in buffer containing 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 10% glycerol, 1 mM PMSF

  • Membrane fraction isolation: Ultracentrifugation at 100,000×g for 1 hour

  • Membrane solubilization: 1% n-dodecyl β-D-maltoside or similar detergent

  • Affinity chromatography: Ni-NTA resin with imidazole gradient elution

  • Buffer exchange: To remove imidazole and reduce detergent concentration

  • Quality assessment: SDS-PAGE for >90% purity

Common Challenges and Solutions:

ChallengeTroubleshooting Approach
Low expression yieldOptimize codon usage; lower induction temperature; use specialized E. coli strains for membrane proteins
Protein aggregationInclude stabilizing agents (glycerol, specific lipids); optimize detergent type and concentration
Impure preparationImplement additional purification steps (ion exchange, size exclusion chromatography)
Loss of activityMaintain reducing environment; minimize exposure to room temperature
Tag interferenceConsider on-column tag cleavage protocols

Researchers should verify protein identity through Western blotting or mass spectrometry and assess protein folding through circular dichroism spectroscopy.

What experimental setup is required to measure the enzymatic activity of B. pseudomallei nuoK as part of the NADH:quinone oxidoreductase complex?

Measuring enzymatic activity of B. pseudomallei nuoK as part of the NADH:quinone oxidoreductase complex requires specialized experimental setups that accommodate membrane protein functionality:

Reconstitution System:

  • Proteoliposome preparation: Incorporate purified protein into liposomes composed of E. coli polar lipids or synthetic mixtures

  • Protein:lipid ratio optimization: Typically 1:50 to 1:100 (w/w)

  • Verification of orientation: Antibody accessibility assays

Activity Measurement Methods:

  • Spectrophotometric assays:

    • NADH oxidation: Monitor absorbance decrease at 340 nm

    • Artificial electron acceptors: DCPIP, coenzyme Q1, ferricyanide

    • Reaction buffer: 50 mM phosphate buffer (pH 7.5), 100 mM NaCl

  • Oxygen consumption assays:

    • Clark-type electrode measurements

    • Reaction conditions: 30°C, saturating NADH concentrations

  • Proton/sodium translocation assays:

    • pH-sensitive fluorescent dyes (ACMA, pyranine)

    • Na+-sensitive fluorescent indicators

Critical Parameters:

  • Temperature control (25-37°C)

  • pH optimization (typically pH 7.0-8.0)

  • Substrate concentration ranges:

    • NADH: 10-500 μM (based on Km values from related systems ranging from 17-258 μM)

    • Quinone analogs: 10-200 μM

Data Analysis:

  • Determine kinetic parameters (Km, Vmax) using Michaelis-Menten or Lineweaver-Burk plots

  • Compare activities with different electron acceptors to characterize preference profiles

  • Evaluate impact of inhibitors to probe mechanism

When designing these experiments, researchers should account for the integration of nuoK within the larger NADH:quinone oxidoreductase complex, as the subunit alone may not show measurable activity without other complex components.

How does nuoK contribute to electron transport chain function in B. pseudomallei, and what methods can assess its impact on bacterial bioenergetics?

The nuoK subunit serves as a critical membrane-embedded component of the NADH:quinone oxidoreductase complex (Complex I) in B. pseudomallei's electron transport chain. This complex catalyzes electron transfer from NADH to ubiquinone coupled with proton translocation across the membrane, generating the proton motive force necessary for ATP synthesis .

Specific contributions of nuoK:

  • Forms part of the membrane domain that constitutes the proton translocation pathway

  • Participates in ubiquinone binding pocket formation

  • Contributes to the stability and assembly of the entire Complex I

  • May influence the iron-sulfur cluster environment critical for electron transfer

Methods to assess bioenergetic impact:

  • Membrane potential measurements:

    • Fluorescent probes (DiSC3(5), JC-1)

    • Quantify changes in wild-type vs. nuoK mutant strains

  • ATP production assays:

    • Luciferase-based ATP quantification

    • Comparison between wild-type and nuoK-deficient strains under different oxygen tensions

  • Oxygen consumption rate analysis:

    • High-resolution respirometry

    • Response to specific inhibitors of respiratory complexes

  • Growth kinetics comparison:

    • Defined media with different carbon sources

    • Aerobic vs. microaerobic conditions to assess metabolic flexibility

  • Gene expression profiling:

    • Transcriptomics (RNA-seq) to map compensatory responses

    • Focus on other respiratory chain components and metabolic pathways

B. pseudomallei is known to occupy environments with limited oxygen, and its versatile genomic features enable it to maintain physiological functions under hypoxic conditions . The nuoK subunit likely plays an important role in this adaptation by contributing to respiratory flexibility when oxygen availability fluctuates.

What is the relationship between nuoK function and bacterial iron metabolism in B. pseudomallei?

The relationship between nuoK function and bacterial iron metabolism in B. pseudomallei represents a complex interplay between respiratory chain components and iron homeostasis:

Recent research on Na+-translocating NADH:quinone oxidoreductase has specifically highlighted its influence on iron metabolism, suggesting it could be a potential drug target for antibiotics . Similar mechanisms may exist in B. pseudomallei, making the nuoK subunit an interesting subject for both basic research and therapeutic development.

How might nuoK function contribute to B. pseudomallei pathogenesis, particularly in the context of intracellular survival and adaptation to hypoxic environments?

The nuoK subunit's function likely contributes significantly to B. pseudomallei pathogenesis through several mechanisms related to energy metabolism and adaptation:

  • Adaptation to oxygen-limited environments:

    • B. pseudomallei commonly occupies environmental niches and infection sites characterized by limited oxygen concentrations

    • The NADH:quinone oxidoreductase complex containing nuoK helps maintain respiratory function under varying oxygen tensions

    • This adaptation is critical for survival in tissue microenvironments within the host, particularly within abscesses or granulomas where oxygen availability is restricted

  • Intracellular energy generation:

    • B. pseudomallei demonstrates robust intracellular replication within host cells

    • The energy requirements for this replication depend on efficient respiratory chain function

    • nuoK, as part of Complex I, contributes to maintaining the proton motive force necessary for ATP synthesis during intracellular growth

  • Resistance to host defense mechanisms:

    • The ability to maintain energy production under stress conditions (including oxidative stress from host immune responses)

    • Potential contribution to resistance against antimicrobial compounds that target bacterial bioenergetics

  • Support for virulence factor expression:

    • Energy supply for the production and secretion of virulence factors

    • Potential regulatory connections between respiratory status and virulence gene expression

Experimental approaches to investigate these connections:

  • Construction of nuoK mutants:

    • Evaluate impact on intracellular survival using human skin fibroblast infection models

    • Assess multinucleated giant cell (MNGC) formation ability

    • Compare metabolic activity of infected host cells

  • Transcriptional profiling:

    • Compare expression of virulence factors between wild-type and nuoK mutants

    • Analyze under normoxic versus hypoxic conditions

  • Animal infection models:

    • Assess virulence of nuoK mutants in appropriate animal models

    • Evaluate tissue tropism and bacterial distribution

B. pseudomallei pathogenesis involves complex mechanisms including invasion, intracellular replication, and MNGC formation . The energy required for these processes depends on efficient respiratory chain function, to which nuoK contributes. Additionally, the bacterium's ability to adapt to different oxygen concentrations is likely crucial for its progression through different stages of infection.

What effects would nuoK gene knockout or inhibition have on B. pseudomallei virulence, and how would researchers design experiments to evaluate these effects?

Knockout or inhibition of the nuoK gene would likely impact B. pseudomallei virulence through disruption of respiratory chain function. A comprehensive experimental design to evaluate these effects would include:

1. Construction of genetic systems:

  • Creation of a clean nuoK deletion mutant using allelic exchange

  • Development of a complemented strain (nuoK+) for validation

  • Generation of a conditionally regulated nuoK expression system

2. In vitro characterization:

ParameterMethodologyExpected Outcome
Growth kineticsGrowth curves in various media and oxygen conditionsReduced growth rate in nuoK mutant, especially under oxygen limitation
Cellular energeticsATP measurements, membrane potential assaysDecreased ATP production and proton motive force
Stress resistanceSurvival assays under oxidative, nitrosative, and acid stressIncreased sensitivity to stressors
Virulence factor expressionqRT-PCR, proteomics, reporter assaysAltered expression profile of key virulence determinants

3. Cellular infection models:

  • Human skin fibroblast infection assays to measure:

    • Invasion efficiency

    • Intracellular multiplication rates at 6, 8, and 10 hours post-infection

    • MNGC formation (quantified using H-score methodology)

    • Host cell metabolic activity (MTT assay)

    • Expression of matrix metalloproteinases (MMP-2, MMP-9)

4. Animal model experiments:

  • Mouse model of acute melioidosis

  • Measurement of bacterial burden in key organs

  • Survival analysis

  • Histopathological examination

  • Immune response characterization

5. Multiomics approaches:

  • Transcriptomics to identify compensatory responses

  • Metabolomics to map metabolic rewiring

  • Proteomics to detect changes in virulence factor production

6. Inhibitor studies (if available):

  • Testing specific inhibitors of nuoK or Complex I

  • Dose-response relationships in cellular models

  • Pharmacokinetic and pharmacodynamic studies in animal models

Based on previous research with B. pseudomallei mutants, we might expect impacts similar to those seen with other respiratory pathway disruptions. For example, the study of SDO metabolism mutants showed alterations in pathogenesis parameters . Additionally, the connection between respiratory function and iron metabolism identified in other bacteria suggests that nuoK inhibition could disrupt multiple aspects of bacterial physiology relevant to virulence .

How can structural studies of B. pseudomallei nuoK contribute to drug discovery efforts targeting respiratory chains of bacterial pathogens?

Structural studies of B. pseudomallei nuoK can significantly advance drug discovery efforts through multiple approaches:

1. High-resolution structural determination:

  • Cryo-electron microscopy of the entire NADH:quinone oxidoreductase complex

  • X-ray crystallography of nuoK alone or in subcomplexes

  • NMR studies of specific domains or interactions

  • Computational modeling based on homologous structures

These approaches would reveal critical features such as:

  • Transmembrane organization and topology

  • Quinone binding sites

  • Conformational changes during catalytic cycle

  • Protein-protein interaction interfaces within the complex

2. Structure-based drug design approaches:

  • Identification of druggable pockets unique to bacterial respiratory complexes

  • Virtual screening of compound libraries against identified binding sites

  • Fragment-based drug design targeting critical functional regions

  • Molecular dynamics simulations to understand ligand interactions

3. Comparison with human mitochondrial Complex I:

  • Detailed structural comparison to identify bacterial-specific features

  • Mapping of sequence and structural divergence

  • Analysis of specific residues critical for function in bacterial but not human complexes

4. Rational inhibitor development strategy:

  • Design compounds that interfere with assembly of the respiratory complex

  • Target bacteria-specific structural elements of nuoK

  • Develop allosteric inhibitors that alter conformational dynamics

  • Create membrane-permeable compounds reaching intracellular bacteria

5. Validation approaches:

  • Biochemical assays with purified complexes

  • Bacterial growth inhibition studies

  • Molecular confirmation of binding (thermal shift assays, isothermal titration calorimetry)

  • Structure-activity relationship development through analog testing

Recent research has highlighted respiratory chain components as viable antibiotic targets . The structural studies of nuoK would be particularly valuable since NADH:quinone oxidoreductases are essential for bacterial energy metabolism, and species-specific structural features could be exploited for selective inhibition without affecting human mitochondrial function.

What are the current technical challenges in studying membrane proteins like nuoK, and what emerging technologies might overcome these limitations?

Studying membrane proteins like nuoK presents significant technical challenges due to their hydrophobicity, complex native environment, and often unstable nature when removed from membranes. Current challenges and emerging solutions include:

1. Expression and purification challenges:

ChallengeTraditional ApproachEmerging Technology
Low expression yieldOptimization of induction conditionsCell-free expression systems with nanodiscs or lipid environments
Protein instabilityDetergent screeningNative nanodiscs, SMALPs (styrene-maleic acid lipid particles)
AggregationAddition of stabilizing agentsDirected evolution for stable variants, computational design
Maintaining native structureGentle solubilizationCryo-EM imaging in native membrane environments

2. Structural determination limitations:

  • Challenge: Obtaining crystals for X-ray crystallography

  • Emerging solutions:

    • Single-particle cryo-electron microscopy for structure determination without crystallization

    • Microcrystal electron diffraction (MicroED) for small crystals

    • Integrative structural biology combining multiple data sources

    • AlphaFold2 and other AI-based structure prediction tools specifically optimized for membrane proteins

3. Functional characterization difficulties:

  • Challenge: Assessing function outside native membrane environment

  • Emerging solutions:

    • Polymer-based membrane mimetics preserving lipid composition

    • High-throughput proteoliposome formation techniques

    • Microfluidic platforms for functional studies

    • Single-molecule functional assays detecting conformational changes

4. Complex assembly and interaction studies:

  • Challenge: Understanding interactions within multiprotein complexes

  • Emerging solutions:

    • Mass photometry for native complex analysis

    • Hydrogen-deuterium exchange mass spectrometry for interaction mapping

    • In-cell fluorescence resonance energy transfer (FRET) for real-time interaction monitoring

    • Cross-linking mass spectrometry (XL-MS) for interaction interface mapping

5. In vivo relevance assessment:

  • Challenge: Connecting in vitro observations to in vivo function

  • Emerging solutions:

    • CRISPR-interference for partial gene knockdown with temporal control

    • Proximity labeling techniques to map protein interactions in native environments

    • High-resolution microscopy techniques for localization studies

    • Genetically encoded sensors for probing membrane protein function in living cells

These technological advances are increasingly being applied to challenging membrane proteins like nuoK, potentially enabling breakthroughs in understanding their structure, function, and role in bacterial pathogenesis. The integration of computational approaches with experimental techniques is particularly promising for accelerating progress in this challenging area of research.

How does B. pseudomallei nuoK compare to homologous proteins in other pathogenic bacteria, and what evolutionary insights can be drawn from these comparisons?

Comparative analysis of B. pseudomallei nuoK with homologs in other bacteria reveals important evolutionary patterns and functional conservation:

Sequence comparison with key bacterial pathogens:

OrganismIdentity (%)Similarity (%)Key Differences
Helicobacter pylori~30-35%~50-55%Shorter sequence (100 aa vs 101 aa); different hydrophobicity pattern
Escherichia coli~40-45%~60-65%Higher conservation in transmembrane domains
Mycobacterium tuberculosis~25-30%~45-50%Divergent in predicted quinone-binding regions
Pseudomonas aeruginosa~55-60%~70-75%Higher conservation reflecting closer evolutionary relationship

Conserved functional domains:

  • Transmembrane helices show the highest conservation, reflecting their structural importance

  • Residues facing the membrane bilayer show greater variability than those facing protein interior

  • Regions involved in proton translocation are highly conserved across species

  • Quinone-binding residues show species-specific adaptations

Evolutionary insights:

  • Selective pressure: Analysis suggests the nuoK subunit has been under purifying selection, maintaining core function while allowing adaptation to different membrane environments

  • Horizontal gene transfer: Limited evidence for horizontal acquisition compared to other virulence factors

  • Co-evolution: Strong correlation with other NADH:quinone oxidoreductase subunits, indicating coordinated evolution of the complex

  • Environmental adaptation: Specific residue differences likely reflect adaptation to different host environments and oxygen availability

Methodological approaches for comparative analysis:

  • Multiple sequence alignment using MUSCLE or CLUSTAL algorithms

  • Phylogenetic tree construction using maximum likelihood methods

  • Structural homology modeling based on available crystal structures

  • Ancestral sequence reconstruction to trace evolutionary trajectory

  • Selection pressure analysis using dN/dS ratios

  • Coevolution analysis with other respiratory chain components

This comparative approach provides insights into both the conserved functional core of nuoK and the species-specific adaptations that may contribute to B. pseudomallei's unique physiological capabilities in diverse environments, including its remarkable ability to thrive under variable oxygen conditions .

What insights can systems biology approaches provide regarding the integration of nuoK function with broader metabolic networks in B. pseudomallei?

Systems biology approaches offer powerful frameworks for understanding how nuoK function integrates with broader metabolic networks in B. pseudomallei, revealing complex regulatory relationships and adaptation mechanisms:

1. Genome-scale metabolic modeling:

  • Construction of a comprehensive metabolic model incorporating respiratory chain components

  • Flux balance analysis to predict metabolic rewiring in response to nuoK mutations

  • Identification of synthetic lethal interactions involving nuoK

  • Simulation of growth under various environmental conditions, particularly varying oxygen tensions

2. Multi-omics integration:

  • Correlation of transcriptomics, proteomics, and metabolomics data

  • Identification of regulatory networks linking respiratory status to broader metabolism

  • Mapping of compensatory pathways activated when nuoK function is compromised

  • Temporal analysis of adaptive responses to respiratory chain disruption

3. Protein-protein interaction networks:

  • Identification of physical and functional interactions involving nuoK

  • Mapping of respiratory supercomplex formation and dynamics

  • Analysis of condition-dependent interaction patterns

  • Determination of nuoK's role in larger protein assemblies beyond Complex I

4. Regulatory network analysis:

  • Identification of transcription factors responding to respiratory chain status

  • Mapping of signaling pathways connecting respiratory function to virulence regulation

  • Analysis of post-translational modifications affecting respiratory complex assembly

  • Small RNA networks potentially regulating nuoK expression

5. Host-pathogen interaction modeling:

  • Systems-level analysis of metabolic competition between host and pathogen

  • Modeling of energetic requirements during different infection phases

  • Integration of host response data with bacterial adaptation mechanisms

  • Prediction of metabolic vulnerabilities during infection

Expected insights from these approaches:

  • Identification of condition-specific metabolic states dependent on nuoK function

  • Understanding of regulatory mechanisms linking respiration to virulence

  • Discovery of potential metabolic vulnerabilities for therapeutic targeting

  • Elucidation of adaptation mechanisms allowing survival under oxygen limitation

Systems biology approaches are particularly relevant for B. pseudomallei given its complex lifestyle, transitioning between environmental survival, acute infection, and persistent infection states. Understanding how nuoK function integrates with these transitions could provide critical insights into bacterial adaptation and identify novel intervention strategies targeting metabolic vulnerabilities.

What characteristics make nuoK a potential drug target, and what experimental approaches would validate its druggability?

Several characteristics position B. pseudomallei nuoK as a potential drug target, alongside specific experimental approaches to validate its druggability:

Key druggability characteristics:

  • Essentiality and conservation: nuoK likely plays an essential role in energy generation, particularly under specific growth conditions relevant to infection . While not completely conserved across all bacteria, it is sufficiently conserved among important pathogens to potentially serve as a broad-spectrum target.

  • Divergence from human homologs: The bacterial NADH:quinone oxidoreductase differs significantly from the mitochondrial Complex I, providing a basis for selective targeting .

  • Membrane accessibility: As a membrane protein, nuoK presents potential binding sites accessible from the periplasmic space, potentially allowing compounds to act without necessarily crossing the inner membrane.

  • Role in pathogenesis: B. pseudomallei's ability to adapt to hypoxic conditions and maintain intracellular replication depends on efficient respiratory chain function .

  • Limited resistance mechanisms: Mutations affecting respiratory chain components often come with significant fitness costs, potentially limiting resistance development.

Experimental validation approaches:

  • Target validation experiments:

    • Construction of conditional knockdown strains to verify essentiality

    • Growth phenotype analysis under different infection-relevant conditions

    • Virulence assessment of nuoK-depleted strains in cellular and animal models

    • Complementation studies to confirm phenotype specificity

  • Druggability assessment:

    • Computational pocket analysis to identify potential binding sites

    • Fragment screening using differential scanning fluorimetry

    • NMR-based ligand screening to detect binding events

    • Molecular dynamics simulations to identify transient binding pockets

  • High-throughput screening approaches:

    • Development of whole-cell screening assays with reporter systems

    • Biochemical assays using reconstituted NADH:quinone oxidoreductase

    • Phenotypic screens under respiratory stress conditions

    • Target-based virtual screening against modeled structures

  • Medicinal chemistry validation:

    • Structure-activity relationship development

    • Physicochemical property optimization for bacterial penetration

    • Assessment of specificity against human mitochondrial Complex I

    • Resistance development frequency determination

The connection between respiratory chain function and iron metabolism identified in related systems suggests that targeting nuoK might have pleiotropic effects beyond simply disrupting energy generation , potentially increasing its value as a therapeutic target. Additionally, B. pseudomallei's reliance on versatile metabolic capabilities for survival in diverse environments suggests that targeting core bioenergetic systems could be particularly effective.

How might inhibitors targeting nuoK affect B. pseudomallei's response to current antibiotics, and what experimental designs would best investigate potential synergistic effects?

Inhibitors targeting nuoK could potentially enhance B. pseudomallei's susceptibility to current antibiotics through several mechanisms, requiring careful experimental designs to investigate these interactions:

Potential mechanisms of synergy:

  • Energy depletion: nuoK inhibition would compromise ATP generation, potentially reducing the effectiveness of energy-dependent resistance mechanisms such as efflux pumps .

  • Membrane potential disruption: NADH:quinone oxidoreductase contributes to proton motive force, which is essential for the function of many transporters and resistance mechanisms .

  • Metabolic rewiring: Respiratory chain disruption forces metabolic adaptation, potentially creating new vulnerabilities to existing antibiotics .

  • Iron homeostasis perturbation: The link between respiratory chain function and iron metabolism suggests that nuoK inhibition might disrupt iron-dependent processes, enhancing susceptibility to certain antibiotics.

  • Oxidative stress enhancement: Respiratory chain dysfunction can increase reactive oxygen species production, potentially synergizing with antibiotics that induce oxidative damage.

Comprehensive experimental design strategy:

  • In vitro synergy screening:

ApproachMethodologyOutcome Measures
Checkerboard assaysMatrix of nuoK inhibitor and antibiotic concentrationsFractional Inhibitory Concentration Index (FICI)
Time-kill studiesBacterial survival over time with single vs. combined agentsLog reduction in CFU over 24 hours
Post-antibiotic effectRecovery after brief exposure to single vs. combined agentsGrowth resumption timing
Resistance developmentSerial passage in subinhibitory concentrationsMutation frequency and adaptation mechanisms
  • Mechanism investigation:

    • Membrane potential measurements using fluorescent probes

    • ATP quantification under combined treatment conditions

    • Transcriptomics to identify affected pathways

    • Proteomics focusing on stress responses and resistance determinants

    • Metabolomics to map metabolic adaptations

  • Cellular infection models:

    • Human skin fibroblast infection model with combination treatments

    • Intracellular antibiotic efficacy assessment

    • Impact on multinucleated giant cell formation

    • Host cell response modulation

  • Ex vivo and in vivo studies:

    • Mouse model of acute melioidosis with combination therapy

    • Pharmacokinetic/pharmacodynamic optimization

    • Tissue penetration assessment

    • Relapse prevention evaluation (critical for melioidosis)

  • Clinical isolate panel testing:

    • Diverse B. pseudomallei clinical isolates with varying resistance profiles

    • Environmental isolates to assess broader applicability

    • Related Burkholderia species to determine spectrum

Targeting respiratory components like nuoK is particularly relevant for B. pseudomallei due to its adaptability to different oxygen conditions and its ability to persist in host tissues . Combination approaches might be especially valuable for treating melioidosis, which often requires prolonged antibiotic therapy and has significant relapse rates. The experimental approaches outlined would provide comprehensive insights into the potential value of nuoK inhibitors as adjuvants to current antibiotics.

What are the most critical unresolved questions regarding B. pseudomallei nuoK that would have the highest impact on advancing both basic science and therapeutic development?

The most critical unresolved questions regarding B. pseudomallei nuoK span fundamental biology to therapeutic potential:

  • Essential nature determination: Is nuoK absolutely essential for B. pseudomallei survival in all conditions, or only under specific environmental or host conditions? Determining conditional essentiality would define its value as a therapeutic target.

  • Structural-functional relationships: What specific residues within nuoK are critical for proton translocation, complex assembly, and quinone interaction? This knowledge would enable rational drug design targeting specific functional aspects.

  • Regulatory networks: How is nuoK expression regulated in response to different environmental conditions, particularly oxygen availability? Understanding this regulation could reveal vulnerabilities in the adaptation process.

  • Host interaction effects: Does nuoK function influence host-pathogen interactions beyond basic energy provision? Potential impacts on virulence factor expression, immune response modulation, or persistence mechanisms remain unexplored.

  • Metabolic integration: How does nuoK function integrate with B. pseudomallei's remarkable metabolic flexibility, particularly during transitions between environmental survival and host infection?

  • Drugability validation: Can selective inhibitors be developed that target bacterial nuoK without affecting human mitochondrial Complex I? This selectivity question is fundamental to therapeutic development.

  • Resistance development risk: What is the likelihood and mechanism of resistance development against nuoK inhibitors, and what would be the fitness costs of such resistance?

  • Combination therapy potential: How would nuoK inhibition specifically enhance the efficacy of current first-line melioidosis treatments (ceftazidime, meropenem, and trimethoprim-sulfamethoxazole)?

Addressing these questions would significantly advance both fundamental understanding of B. pseudomallei physiology and potentially lead to novel therapeutic approaches for melioidosis, a disease with limited treatment options and significant mortality. The integration of multidisciplinary approaches spanning structural biology, genetics, biochemistry, and infection models would be essential to make meaningful progress on these critical knowledge gaps.

How might the research methodology used to study nuoK in B. pseudomallei be applied to investigate similar proteins in other pathogens of clinical significance?

The research methodology developed for B. pseudomallei nuoK can establish a valuable framework for investigating similar proteins across various pathogens, creating translatable approaches with broad implications:

1. Genetic manipulation strategies:

  • CRISPR-Cas9 based genome editing protocols optimized for membrane protein studies

  • Conditional expression systems that allow titration of expression levels

  • Fluorescent protein fusion strategies that preserve membrane protein function

  • Site-directed mutagenesis pipelines for structure-function analysis

2. Biochemical characterization techniques:

  • Membrane protein purification protocols adaptable to different bacterial species

  • Activity assay systems for respiratory chain components with standardized parameters

  • Detergent and lipid optimization approaches for protein stability

  • Reconstitution methods that maintain native-like environments

3. Structural biology approaches:

  • Cryo-EM sample preparation methods for membrane protein complexes

  • Computational modeling frameworks for homology-based prediction

  • Fragment screening procedures specific to membrane proteins

  • Mass spectrometry workflows for membrane protein analysis

4. Pathogenesis model systems:

  • Standardized cellular infection protocols adaptable to different bacterial pathogens

  • Tissue-specific models that recapitulate relevant infection microenvironments

  • Multi-parameter virulence assessment frameworks

  • Host response measurement systems with translatable markers

5. Drug discovery pipelines:

  • Target validation criteria applicable across bacterial species

  • Screening cascades designed for respiratory chain targets

  • Pharmacophore models for respiratory chain inhibitors

  • Resistance development assessment protocols

Application to priority pathogens:

PathogenRespiratory Chain TargetResearch Adaptation Needed
Mycobacterium tuberculosisNDH-2 (alternative NADH dehydrogenase)Modification for slow-growing organism; hypoxia models
Acinetobacter baumanniiComplex I componentsFocus on resistance mechanisms; biofilm contexts
Pseudomonas aeruginosaCytochrome oxidasesAdaptation for quorum sensing interactions
Staphylococcus aureusMenaquinone-dependent systemsAdjustment for Gram-positive membrane architecture
Klebsiella pneumoniaeNuoK homologsIntegration with capsule production studies

The methodological framework developed for B. pseudomallei nuoK research would be particularly valuable for studying respiratory chain components in other intracellular pathogens and those that encounter variable oxygen tensions during infection. The adaptable approaches would accelerate target validation across multiple pathogens, potentially leading to broad-spectrum therapeutic strategies targeting conserved respiratory chain vulnerabilities.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.