Recombinant Burkholderia pseudomallei Probable intracellular septation protein A (BPSL1420)

What is BPSL1420 and what is its significance in research?

BPSL1420 is a probable intracellular septation protein A from Burkholderia pseudomallei strain K96243, also known as yciB or inner membrane-spanning protein YciB. This protein is of significant research interest due to its potential role in bacterial cell division and possible contribution to pathogenesis. Based on comparative analysis with homologous proteins like ispA in Shigella flexneri, BPSL1420 likely plays an essential role in bacterial septation during cell division . Understanding this protein could provide insights into B. pseudomallei virulence mechanisms and potential therapeutic targets, as mutations in similar proteins have been shown to affect bacterial spreading capabilities and virulence in other pathogens .

What are the basic structural characteristics of BPSL1420?

BPSL1420 is a full-length protein consisting of 176 amino acids with a molecular weight likely around 20-21 kDa, based on comparison with similar proteins . Its amino acid sequence is: MKFLFDLFPIILFFAAFKLWGIFTATAVAIAATLAQVAWVAFRHRKVDTMLWVSLGVIVVFGGATLVLHDEKFIQWKPTVLYWLFAVGLVAARYAFGKNLIEKMMGKQLTLPEPVWDKLNLAWAAFFAALGVTNLYVVRNFTESQWVNFKLFGTTGAIVVFVILQSLWLAKYLKEE . The protein is characterized by its highly hydrophobic nature, suggesting it is an integral membrane protein with multiple transmembrane domains . This hydrophobicity presents specific challenges for expression, purification, and structural studies, requiring specialized approaches compared to soluble proteins.

How does BPSL1420 compare to similar proteins in other bacterial species?

BPSL1420 shares functional and structural similarities with the ispA protein identified in Shigella flexneri. In S. flexneri, ispA codes for a small (21 kDa), very hydrophobic protein that is essential for virulence . Mutation of ispA in S. flexneri results in defects in cell division, leading to the formation of long filamentous bacteria lacking septa and affecting the bacteria's ability to polymerize actin, which is required for intercellular spreading . Given these similarities, BPSL1420 may play comparable roles in B. pseudomallei, potentially affecting cell division and virulence. Researchers studying BPSL1420 should consider these parallels when designing experiments and interpreting results, while being cautious not to assume identical functions across different bacterial species without experimental validation.

What expression systems are available for producing recombinant BPSL1420?

Multiple expression systems have been developed for producing recombinant BPSL1420, each with distinct advantages for different research applications. The protein has been successfully expressed in:

• E. coli expression systems - Most commonly used due to ease of manipulation, rapid growth, and high protein yields .

• Yeast expression systems - Useful for proteins requiring eukaryotic post-translational modifications .

• Baculovirus expression systems - Offers advantages for complex proteins that may be toxic to bacterial hosts .

• Mammalian cell expression systems - Provides the most authentic post-translational modifications and protein folding environment for functional studies .

The choice of expression system should be determined by the research question being addressed. For basic structural studies, E. coli systems may be sufficient, while functional studies might benefit from eukaryotic expression systems. It's worth noting that approximately 50% of recombinant proteins fail to be expressed in host cells, so optimization may be required regardless of the chosen system .

What are the key methodological considerations for optimizing BPSL1420 expression in E. coli?

Optimizing expression of BPSL1420 in E. coli requires careful consideration of several factors:

• Vector selection: Vectors with different copy numbers can significantly impact expression. High-copy vectors like pUC series (500-700 copies per cell) provide higher gene dosage but may stress the host cell, while moderate-copy vectors like pET series (15-60 copies) or low-copy vectors like pSC101 (<5 copies) may be more suitable for toxic or membrane proteins like BPSL1420 .

• Translation initiation optimization: The accessibility of translation initiation sites is crucial for successful expression. Modeling mRNA base-unpairing across the Boltzmann's ensemble can predict expression success, and tools like TIsigner can suggest synonymous substitutions in the first nine codons to improve expression levels .

• Expression conditions: For membrane proteins like BPSL1420, lower induction temperatures (15-25°C) and reduced inducer concentrations often improve proper folding and reduce inclusion body formation.

• Host strain selection: E. coli strains with mutations in proteases or those designed for membrane protein expression may improve yields of functional BPSL1420.

• Fusion tags: The addition of solubility-enhancing tags or appropriate signal sequences can improve membrane protein expression and facilitate purification. BPSL1420 has been successfully produced with an N-terminal 10xHis-tag .

Researchers should be prepared to test multiple combinations of these factors to optimize expression of this challenging membrane protein.

What purification strategies are most effective for recombinant BPSL1420?

Purifying recombinant BPSL1420 presents specific challenges due to its hydrophobic nature and membrane association. Effective purification strategies include:

• Affinity chromatography: Using tagged versions of the protein (e.g., His-tagged BPSL1420) allows for specific capture on appropriate affinity resins under conditions that maintain protein solubility . Detergent selection is critical during this step.

• Detergent selection: Given the hydrophobic nature of BPSL1420, proper detergent selection is crucial. Mild detergents like n-dodecyl-β-D-maltoside (DDM) or n-octyl-β-D-glucopyranoside (OG) are often effective for membrane protein extraction while preserving protein structure.

• Size exclusion chromatography: This can be used as a polishing step to remove aggregates and ensure homogeneous protein preparation.

• Buffer optimization: Stability of BPSL1420 during purification and storage is dependent on buffer composition. Tris/PBS-based buffers with stabilizing agents like trehalose (6%) at pH 8.0 have been reported as effective for maintaining protein stability .

• Storage considerations: Purified BPSL1420 should be stored at -20°C or -80°C, with aliquoting recommended to avoid repeated freeze-thaw cycles that can lead to protein degradation or aggregation .

Combining these approaches in a systematic purification strategy can yield high-quality BPSL1420 suitable for structural and functional studies.

What is known about the structure-function relationship of BPSL1420?

The structure-function relationship of BPSL1420 remains largely inferred from homologous proteins rather than directly determined. Based on homology to ispA in S. flexneri, BPSL1420 likely functions in bacterial cell division and septation processes . The protein's highly hydrophobic nature suggests multiple membrane-spanning domains that anchor it within the bacterial inner membrane .

Functionally, mutation studies in homologous proteins indicate that these septation proteins are critical for proper bacterial cell division, with mutations leading to filamentous growth due to incomplete septation . In S. flexneri, ispA mutation also affected actin polymerization, suggesting a potential multifunctional role that extends beyond septation to interaction with host cellular processes during infection .

The specific structural elements responsible for these functions haven't been thoroughly characterized for BPSL1420. Detailed structural studies using techniques such as X-ray crystallography or cryo-electron microscopy would be necessary to establish direct structure-function relationships, though these are challenging to perform with membrane proteins.

How does the amino acid sequence of BPSL1420 inform its potential function?

The 176 amino acid sequence of BPSL1420 (MKFLFDLFPIILFFAAFKLWGIFTATAVAIAATLAQVAWVAFRHRKVDTMLWVSLGVIVVFGGATLVLHDEKFIQWKPTVLYWLFAVGLVAARYAFGKNLIEKMMGKQLTLPEPVWDKLNLAWAAFFAALGVTNLYVVRNFTESQWVNFKLFGTTGAIVVFVILQSLWLAKYLKEE) provides important insights into its potential function .

Analysis of this sequence reveals:

• High hydrophobicity profile: The abundance of hydrophobic residues (F, L, I, V, A) suggests multiple transmembrane domains, consistent with its predicted role as an inner membrane protein.

• Conserved domains: Comparison with homologous proteins may reveal conserved regions that are likely crucial for function, particularly in septation processes.

• Potential functional motifs: The sequence should be analyzed for motifs that might indicate interaction with other proteins in the septation machinery or with host cell components.

• Evolutionary conservation: Regions of high evolutionary conservation across bacterial species likely represent functionally important domains.

Without experimental validation, these sequence-based predictions provide a starting point for targeted functional studies and mutagenesis experiments to determine which regions of the protein are essential for its biological activity.

What experimental approaches are recommended for studying the function of BPSL1420 in B. pseudomallei?

To elucidate the function of BPSL1420 in B. pseudomallei, several experimental approaches are recommended:

• Targeted gene knockout/knockdown: Creating BPSL1420 mutants in B. pseudomallei and assessing the resulting phenotypes, similar to the approach used with ispA in S. flexneri . This could reveal defects in cell division, morphology, or virulence.

• Complementation studies: Testing whether BPSL1420 can complement ispA mutations in other bacterial species or vice versa to confirm functional conservation.

• Protein localization: Using fluorescent protein fusions or immunolocalization to determine the precise subcellular localization of BPSL1420 during different growth phases and cell division stages.

• Protein-protein interaction studies: Employing techniques such as bacterial two-hybrid systems, co-immunoprecipitation, or proximity labeling to identify interaction partners involved in septation or other cellular processes.

• Structural studies: Utilizing advanced techniques suitable for membrane proteins, such as cryo-electron microscopy or solid-state NMR, to determine the three-dimensional structure.

• Cell infection models: Evaluating the impact of BPSL1420 mutations on bacterial invasion, intracellular survival, and intercellular spreading in appropriate cell culture models.

• Animal infection models: Assessing the virulence of BPSL1420 mutants in appropriate animal models to understand its role in pathogenesis.

These approaches, used in combination, would provide comprehensive insights into the functional role of BPSL1420 in B. pseudomallei biology and pathogenesis.

What is the potential significance of BPSL1420 in B. pseudomallei virulence?

The potential significance of BPSL1420 in B. pseudomallei virulence can be inferred from studies of homologous proteins in other bacterial pathogens. In Shigella flexneri, the homologous ispA gene was found to be essential for virulence, with mutation resulting in bacteria incapable of spreading throughout epithelial cell monolayers . The ispA mutation in S. flexneri led to defects in cell division and the inability to polymerize actin, which is crucial for intra- and inter-cellular spreading .

By extension, BPSL1420 might play similar roles in B. pseudomallei virulence, potentially affecting:

How might BPSL1420 serve as a target for therapeutic development?

BPSL1420 presents several characteristics that make it a potentially attractive target for therapeutic development against B. pseudomallei infections:

• Essential function: If BPSL1420 proves essential for B. pseudomallei viability or virulence, similar to ispA in S. flexneri , inhibitors targeting this protein could effectively control infection.

• Bacterial specificity: As a bacterial-specific protein with no close homologs in humans, targeting BPSL1420 could potentially minimize off-target effects on host cells.

• Membrane localization: The predicted membrane localization of BPSL1420 makes it potentially accessible to drugs without needing to penetrate the bacterial cytoplasm.

• Role in septation: Disrupting bacterial cell division by targeting BPSL1420 could lead to filamentous growth and attenuated virulence, as observed with ispA mutants in S. flexneri .

Therapeutic approaches might include:

• Small molecule inhibitors designed to bind specific domains of BPSL1420

• Peptide-based inhibitors that disrupt protein-protein interactions involving BPSL1420

• Antibody-based approaches if any domains are exposed to the periplasm or extracellular space

Can BPSL1420 be utilized in immunological studies or vaccine development?

The potential of BPSL1420 for immunological studies or vaccine development depends on several factors that require experimental validation:

• Immunogenicity: Recombinant bacterial proteins have shown variable immunogenicity in previous studies. For example, research with Brucella cell surface proteins demonstrated that some recombinant proteins induced immune responses while others did not . Studies would need to determine if BPSL1420 can elicit significant antibody or T-cell responses.

• Accessibility to the immune system: As a probable inner membrane protein , BPSL1420 may have limited exposure to the host immune system during natural infection. This could reduce its utility as a vaccine antigen unless specific immunogenic epitopes are exposed.

• Protective efficacy: Even immunogenic proteins don't necessarily confer protection. In studies with Brucella proteins, recombinant protein vaccines did not induce protective responses comparable to those of whole cell surface protein preparations . Similar evaluations would be needed for BPSL1420.

• Combination approaches: If used in vaccines, BPSL1420 might be more effective as part of a multi-component formulation. Research has shown that combined subcomponents can have different immunogenic properties than individual proteins .

• Diagnostic applications: Even if not suitable for vaccines, recombinant BPSL1420 could potentially serve as an antigen in diagnostic assays for B. pseudomallei infection, similar to how other bacterial proteins have been used in serological tests.

What are the major challenges in studying BPSL1420 and how can they be addressed?

Studying BPSL1420 presents several significant challenges due to its nature as a membrane protein and its origin from a pathogenic organism. Major challenges include:

• Expression difficulties: Approximately 50% of recombinant proteins fail to be expressed in host cells , with membrane proteins like BPSL1420 being particularly challenging. This can be addressed by:

  • Optimizing translation initiation sites using computational tools like TIsigner

  • Testing multiple expression systems including specialized strains for membrane proteins

  • Using fusion tags and optimized codon usage for the host organism

• Purification complexities: Membrane proteins require detergents for extraction and purification, which can affect protein structure and function. Solutions include:

  • Systematic screening of detergent types and concentrations

  • Utilizing nanodiscs or amphipols as alternatives to traditional detergents

  • Employing mild solubilization conditions to maintain native-like structure

• Structural characterization: Membrane proteins are underrepresented in structural databases due to difficulties in crystallization. Researchers can:

  • Employ cryo-electron microscopy, which has revolutionized membrane protein structure determination

  • Use NMR for structural studies of specific domains or fragments

  • Apply computational modeling based on homologous proteins with known structures

• Biosafety concerns: B. pseudomallei is a Tier 1 select agent requiring specialized containment facilities. Researchers can:

  • Work with non-pathogenic surrogate systems for initial studies

  • Use recombinant expression of BPSL1420 in safe host organisms

  • Collaborate with specialized high-containment laboratories for studies requiring the native organism

• Functional assessment: Determining the precise function of BPSL1420 requires multiple approaches, including:

  • Creating conditional mutants if the gene proves essential

  • Using inducible knockdown systems to study partial loss of function

  • Developing cell-free assays for specific biochemical activities

How can advanced computational approaches enhance BPSL1420 research?

Advanced computational approaches can significantly enhance research on BPSL1420 in several ways:

• Protein structure prediction:

  • AlphaFold2 and similar AI-based tools can predict the three-dimensional structure of BPSL1420 with increasing accuracy

  • Molecular dynamics simulations can model the protein's behavior within a lipid bilayer

  • These predictions can guide experimental design for mutagenesis and functional studies

• Expression optimization:

  • Tools like TIsigner can model mRNA base-unpairing across the Boltzmann's ensemble to predict expression success and suggest modifications

  • Codon optimization algorithms can enhance expression in different host systems

  • Signal sequence prediction tools can optimize membrane insertion

• Evolutionary analysis:

  • Phylogenetic analysis can identify conserved domains across bacterial species

  • Analysis of selection pressure on different protein regions can reveal functionally important sites

  • Coevolution analysis can predict interaction partners within bacterial septation machinery

• Drug design applications:

  • Virtual screening of compound libraries against predicted BPSL1420 structure

  • Structure-based design of potential inhibitors targeting critical functional sites

  • Molecular docking simulations to predict binding modes of candidate compounds

• Systems biology integration:

  • Network analysis to position BPSL1420 within the broader context of bacterial cell division

  • Computational models of septation incorporating BPSL1420 function

  • Predictive models of bacterial response to BPSL1420 inhibition

These computational approaches can complement experimental work, potentially reducing the time and resources needed for discovery while generating testable hypotheses about BPSL1420 function and interactions.

What are the latest methodological advances relevant to BPSL1420 membrane protein research?

Several cutting-edge methodological advances have emerged that are particularly relevant to membrane protein research like BPSL1420:

• Cryo-electron microscopy (cryo-EM) advancements:

  • Single-particle cryo-EM now routinely achieves near-atomic resolution for membrane proteins

  • Advances in sample preparation techniques, including improved grids and vitrification methods

  • Software improvements for image processing that can handle smaller proteins like BPSL1420

• Novel membrane mimetics:

  • Nanodiscs with customizable lipid compositions to better mimic the native membrane environment

  • Styrene-maleic acid lipid particles (SMALPs) that extract membrane proteins with their surrounding lipids

  • Cell-free expression systems combined with artificial membranes for direct insertion during synthesis

• Mass spectrometry innovations:

  • Native mass spectrometry to analyze intact membrane protein complexes

  • Hydrogen-deuterium exchange mass spectrometry for studying protein dynamics and interactions

  • Cross-linking mass spectrometry to map interaction interfaces with other proteins

• Single-molecule techniques:

  • Super-resolution microscopy to visualize BPSL1420 localization during septation

  • Single-molecule FRET to monitor conformational changes during function

  • Atomic force microscopy to study topography and mechanical properties

• Cell-free expression systems:

  • Specialized cell-free systems optimized for membrane protein expression

  • Continuous exchange cell-free systems that can run for extended periods

  • Incorporation of defined lipid environments during translation

• Genetic tools:

  • CRISPR-Cas9 systems adapted for precise genome editing in B. pseudomallei

  • Conditional expression systems for essential genes

  • Regulated protein degradation systems to study the effects of acute protein depletion

These methodological advances offer new opportunities for overcoming traditional challenges in membrane protein research and could significantly accelerate understanding of BPSL1420 structure, function, and potential as a therapeutic target.

What are the most promising future research directions for BPSL1420?

Based on current knowledge and research gaps, the most promising future research directions for BPSL1420 include:

• Comprehensive structural characterization: Determining the three-dimensional structure of BPSL1420 using advanced techniques like cryo-EM or X-ray crystallography would provide crucial insights into function and potential druggable sites.

• Detailed functional analysis in B. pseudomallei: Generating conditional mutants and studying the effects on bacterial growth, division, and virulence would establish the precise role of BPSL1420 in this pathogen's biology.

• Host-pathogen interaction studies: Investigating whether BPSL1420 interacts with host cell components, similar to how ispA affects actin polymerization in Shigella , could reveal new aspects of B. pseudomallei pathogenesis.

• Drug discovery targeting BPSL1420: If validated as essential for bacterial viability or virulence, developing high-throughput screening assays to identify inhibitors could lead to novel therapeutic approaches.

• Comparative analysis across bacterial pathogens: Systematic comparison of BPSL1420 homologs across multiple bacterial species could identify conserved functional mechanisms and species-specific adaptations.

• Systems-level integration: Positioning BPSL1420 within the broader network of proteins involved in bacterial cell division through interactome studies could provide a more comprehensive understanding of its function.

These research directions would not only advance fundamental knowledge about bacterial septation proteins but could also contribute to applied outcomes such as new diagnostic tools or therapeutic approaches for B. pseudomallei infections.

How does current research on BPSL1420 contribute to broader understanding of bacterial septation processes?

Research on BPSL1420 contributes significantly to the broader understanding of bacterial septation processes in several ways:

• Evolutionary conservation: Studies of BPSL1420 and its homologs like ispA in S. flexneri highlight evolutionarily conserved mechanisms of bacterial cell division across diverse bacterial species, helping to identify core components of this essential process.

• Membrane protein function: As a probable integral membrane protein , BPSL1420 research provides insights into how membrane-embedded proteins contribute to the complex process of bacterial septation, potentially revealing novel structural and functional principles.

• Virulence connections: The link between septation proteins and virulence, as demonstrated with ispA in S. flexneri , reveals how fundamental cellular processes can directly impact pathogenesis, suggesting that cell division proteins may play dual roles in bacterial physiology and host interaction.

• Drug target potential: Investigation of BPSL1420 as a potential drug target could establish principles for targeting bacterial septation as an antibacterial strategy, potentially applicable to multiple bacterial pathogens beyond B. pseudomallei.

• Methodology development: Technical advances developed to study challenging membrane proteins like BPSL1420, such as expression optimization and purification strategies , contribute to the broader toolkit available for membrane protein research across fields.

By positioning BPSL1420 research within this broader context, findings from this specific protein can inform fundamental understanding of bacterial cell division while also contributing to applied research in antimicrobial development.

What interdisciplinary approaches might accelerate progress in BPSL1420 research?

Accelerating progress in BPSL1420 research requires interdisciplinary approaches that integrate diverse expertise and methodologies:

• Structural biology and biophysics: Combining techniques like cryo-EM, NMR, and computational modeling to overcome challenges in membrane protein structure determination.

• Microbiology and cellular biology: Integrating traditional microbiology with advanced cellular imaging to understand BPSL1420's role in bacterial physiology and host-pathogen interactions.

• Genetics and molecular biology: Applying cutting-edge genetic tools for precise manipulation of BPSL1420 expression and function in its native context.

• Bioinformatics and computational biology: Leveraging big data approaches to position BPSL1420 within broader biological networks and predict functional interactions.

• Medicinal chemistry and pharmacology: Translating biological insights into rational drug design approaches targeting BPSL1420 or related pathways.

• Immunology and vaccinology: Evaluating the potential of BPSL1420 as a diagnostic marker or vaccine component through systematic immunological characterization.

• Systems biology and synthetic biology: Using bottom-up and top-down approaches to understand how BPSL1420 integrates into cellular systems and how these systems might be manipulated.