Recombinant Burkholderia pseudomallei Probable ubiquinone biosynthesis protein UbiB (ubiB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we will prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ubiB; BURPS1106A_0686; Probable protein kinase UbiB; Ubiquinone biosynthesis protein UbiB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-525
Protein Length
full length protein
Species
Burkholderia pseudomallei (strain 1106a)
Target Names
ubiB
Target Protein Sequence
MRIFRFVKIVFTVIRFGLDEVMLSRIENPRVKLLLRITTIGRRFADPPAVRLRRALESLG PIFVKFGQVLSTRRDLLPVDFANELAKLQDQVPPFDSAVAIAIVEKSLGARIDVLFDEFE RVPVASASIAQVHFAKLKQGEHKGKAVAVKVLRPNMLPVIDSDLALMRDIATWAERLWAD GRRLKPREVVAEFDKYLHDELDLMREAANGSQLRRNFAGLDLLLVPEMFWDYSTPAVLVM ERMTGVPISQVDTLRAAGVDIPKLAREGVEIFFTQVFRDGFFHADMHPGNIQVSLDPKHF GRYIALDFGIVGALSDFDKNYLAQNFLAFFKRDYHRVATLHLESGWVPPDTRVEELESAI RAVCEPYFDRALKDISLGQVLMRLFSTSRRFNVEIQPQLVLLQKTMLNVEGLGRSLDPEL DLWKTAKPYLERWMTEQIGLRGWYERFKVEAPQWSKTLPQLPRLVHQALISHHEAPRAIS DDLIRQILVEQRRTNRLLQALLVFGLAVGAGAVIARVLIVLAYGG
Uniprot No.

Target Background

Function
This protein is likely a kinase regulator of UbiI activity, involved in the aerobic biosynthesis of coenzyme Q (ubiquinone).
Database Links
Protein Families
ABC1 family, UbiB subfamily
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is Burkholderia pseudomallei and why is the ubiquinone biosynthesis protein UbiB significant?

Burkholderia pseudomallei is a flagellated Gram-negative bacterium that causes melioidosis, a disease posing major public health problems in tropical regions. Melioidosis has a high mortality rate associated with severe sepsis involving overwhelming production of pro-inflammatory cytokines . The ubiquinone biosynthesis protein UbiB is classified as a probable component of the ubiquinone (coenzyme Q) biosynthetic pathway. This pathway is essential for aerobic respiration in many bacteria, making UbiB potentially important for B. pseudomallei survival and pathogenesis. Given that respiratory chain components are often critical for bacterial fitness during infection, understanding UbiB's function could provide insights into B. pseudomallei physiology and potential therapeutic targets.

What is the molecular structure and sequence information for B. pseudomallei UbiB protein?

The B. pseudomallei (strain 1710b) UbiB protein consists of 525 amino acids with the UniProt accession number Q3JVZ2 . The amino acid sequence is:
MRIFRFVKIVFTVIRFGLDEVMLSRIENPRVRLLRITTIGRFADPPAVRLRRALESLAKEDKVLLDLWQKFPIFVKFGQVLSTRRDLLPVDFANELAKLQDQVPPFDSAVAIAIVEKSLGARIDVLFDEFERYPVASASIAQVHFAKLKQGEHKGKAVAVKVLRPNMLPVIDSDALALMRDIATWARLWADGRRLKPREVVAEFDKYLHDELDLAREAMGSQLRRNFAGLDLLLVPEMFWDYSTPAVLVMERMTGVPISQVDTLRAAGVDIPKLAREGVEIFFTQVFRDGFFHADMHPGNIQVSLDPKHFGRYIALDFGIVGALSDFDKNYLAQNFLAFFKRDYHRVATLHLESGWVPPDTRVEELESAIRAVCEPYFDRALKDISLGQVLMRLFTSRRFNVEIQPQLVLLQKTMLNVEGLGRSLDPELDLWKTAKPYLERWMTEQIGLRGWYERFKVEAPQWSKTLPQLPRLVHQALISHHEAPRAISDDLIRQILVEQRRTNRLLQALLVFGLAVGAGAVIARVLIVLAYGG

The protein structure would typically be determined using techniques such as X-ray crystallography or cryo-electron microscopy, though specific structural data for B. pseudomallei UbiB is not provided in the search results. Researchers should consider homology modeling based on related UbiB proteins if experimental structures are unavailable.

How should recombinant B. pseudomallei UbiB protein be stored and handled in laboratory settings?

Based on manufacturer recommendations for recombinant proteins of this nature, the optimal storage conditions for recombinant B. pseudomallei UbiB include keeping the protein at -20°C for regular storage, and at -80°C for extended storage . The protein is typically supplied in a Tris-based buffer with 50% glycerol, optimized for protein stability . It is advisable to avoid repeated freezing and thawing cycles, which can lead to protein denaturation. For working with the protein, prepare smaller aliquots that can be stored at 4°C for up to one week . When handling, researchers should follow biosafety protocols appropriate for working with proteins derived from BSL-3 pathogens, even though recombinant proteins themselves may not be infectious.

What expression systems are recommended for producing recombinant B. pseudomallei UbiB?

While the search results don't specify the expression system used for UbiB, methodological approaches can be inferred from similar recombinant protein production. For bacterial proteins like UbiB, Escherichia coli-based expression systems are commonly employed. Researchers typically clone the ubiB gene into an expression vector containing an appropriate promoter (such as T7) and a purification tag (such as His-tag or GST-tag). The choice of tag will be determined during the production process to optimize protein yield and activity .

For challenging bacterial proteins, alternative expression systems such as Pseudomonas-based systems or cell-free protein synthesis might be considered. When expressing membrane-associated proteins like those involved in ubiquinone biosynthesis, specialized E. coli strains designed for membrane protein expression may yield better results. Purification typically involves affinity chromatography followed by size exclusion or ion exchange chromatography to achieve high purity.

How does UbiB contribute to B. pseudomallei pathogenesis and virulence mechanisms?

While direct evidence of UbiB's role in B. pseudomallei virulence is not explicitly stated in the search results, we can develop methodological approaches to investigate this question. Ubiquinone is crucial for bacterial respiratory chains, and disruption of its biosynthesis likely impacts bacterial survival under stress conditions encountered during infection. Research with other bacterial pathogens suggests that ubiquinone biosynthesis proteins contribute to virulence by:

  • Supporting energy production during infection

  • Protecting against oxidative stress generated by host immune responses

  • Contributing to membrane integrity under stress conditions

To investigate UbiB's role in virulence, researchers should consider generating ubiB knockout mutants and comparing their growth, survival, and virulence to wild-type B. pseudomallei in relevant infection models. Studies have shown that B. pseudomallei mutants lacking key biosynthetic genes can exhibit reduced virulence in murine macrophage and BALB/c mouse models, as demonstrated with other biosynthetic pathways . Assessment of intracellular replication in macrophage cell lines (such as RAW 264.7) would provide insights into whether UbiB affects bacterial survival within host cells, similar to methodologies used for other B. pseudomallei virulence factors .

What is the relationship between UbiB and respiratory mechanisms in B. pseudomallei?

UbiB likely plays a critical role in B. pseudomallei respiratory mechanisms through its function in ubiquinone biosynthesis. Ubiquinone (coenzyme Q) serves as an electron carrier in the respiratory chain of many bacteria, facilitating aerobic and anaerobic respiration. The search results indicate that B. pseudomallei can inhibit the growth of environmental bacterial isolates through competition mechanisms , which may partially relate to respiratory efficiency.

The relationship between respiratory mechanisms and bacterial competition is particularly evident in the finding that B. pseudomallei can inhibit bacteria "that utilize naphthoquinones such as MK and DMK for aerobic respiration" . This suggests complex interactions between different respiratory pathways and competitive fitness. To investigate UbiB's specific contributions:

  • Measure oxygen consumption rates in wild-type versus ubiB-deficient strains

  • Quantify ubiquinone levels using HPLC or LC-MS/MS methods

  • Assess growth under different oxygen concentrations and carbon sources

  • Evaluate survival under oxidative stress conditions that might be encountered during infection

These approaches would provide insights into how UbiB-mediated ubiquinone biosynthesis supports B. pseudomallei metabolism and survival.

How can recombinant UbiB be used for immunological studies and potential vaccine development?

While UbiB's specific immunogenicity is not addressed in the search results, methodological approaches can be derived from studies of other B. pseudomallei proteins. For instance, research on recombinant flagellin (FliC) has demonstrated successful investigation of both innate and adaptive immune responses . Similar approaches could be applied to UbiB:

For innate immunity studies:

  • Stimulate human cell lines (like HEK-Blue-hTLR cells) with purified recombinant UbiB to assess activation of pattern recognition receptors

  • Perform whole blood stimulation assays and measure pro-inflammatory cytokine production (IL-1β, IL-6, and TNF-α) in response to UbiB

  • Compare responses between different donor populations (healthy individuals versus melioidosis patients with or without comorbidities like diabetes)

For adaptive immunity assessment:

  • Develop ELISA assays using recombinant UbiB to detect specific antibodies in serum samples from melioidosis patients

  • Compare antibody levels between different patient groups, as was done with FliC where researchers found that "IgG antibody to rFliC in melioidosis patients with diabetes were higher compared with non-diabetic patients"

  • Assess T-cell responses to UbiB epitopes using techniques such as ELISpot or flow cytometry

These approaches would determine whether UbiB is immunogenic and potentially useful for diagnostic or vaccine development purposes.

What experimental approaches should be used to characterize UbiB enzyme activity and inhibition?

To characterize UbiB enzyme activity, researchers should employ a multi-faceted approach combining biochemical and genetic methods:

  • In vitro enzymatic assays:

    • Purify recombinant UbiB and establish assay conditions reflecting physiological parameters

    • Measure ubiquinone precursor conversion using HPLC or LC-MS

    • Determine kinetic parameters (Km, Vmax, kcat) for the enzyme with various substrates

  • Genetic complementation studies:

    • Express B. pseudomallei UbiB in E. coli ubiB-deficient strains to confirm functional conservation

    • Assess restoration of ubiquinone synthesis and respiratory capacity

  • Inhibitor screening:

    • Develop high-throughput screening assays for UbiB inhibitors

    • Evaluate promising compounds for specificity against bacterial versus human homologs

    • Test inhibitors' effects on bacterial growth and survival in culture

Research on other B. pseudomallei enzymes has shown that inhibitor identification can lead to potential therapeutic candidates. For example, the search results mention a "previously described Burkholderia ambifaria HmqD enzyme inhibitor exhibited strong activity against the production of MAQs and MAQNOs by B. pseudomallei and may represent a novel melioidosis therapeutic countermeasure" . Similar approaches could be applied to identify UbiB inhibitors as potential antimicrobial agents.

How does UbiB interact with other biosynthetic pathways in B. pseudomallei?

Investigating UbiB's interactions with other biosynthetic pathways requires a systems biology approach:

  • Transcriptomic analysis:

    • Compare gene expression profiles between wild-type and ubiB mutant strains

    • Identify compensatory changes in related pathways

    • Analyze under various growth conditions to detect condition-specific interactions

  • Metabolomic studies:

    • Quantify changes in metabolite pools in ubiB mutants versus wild-type

    • Focus on intermediates of related pathways (respiratory chain components, other quinones, etc.)

  • Protein-protein interaction studies:

    • Perform co-immunoprecipitation with tagged UbiB to identify interaction partners

    • Use bacterial two-hybrid systems to confirm specific interactions

    • Conduct crosslinking studies to capture transient interactions

Given that B. pseudomallei harbors "a diverse array of biosynthetic gene clusters (BGCs) that encode natural products with potential uses in medicine and agriculture" , understanding how UbiB relates to these various pathways could reveal important regulatory mechanisms and potential intervention points. Research indicates that as many as "21 distinct BGCs have been bioinformatically identified in the genomic sequences of B. pseudomallei strains" , highlighting the complex biosynthetic network in which UbiB functions.

Future Research Directions and Priorities

Research on B. pseudomallei UbiB presents several promising avenues for future investigation. Priority areas should include:

  • Structural biology approaches to determine UbiB's three-dimensional structure and catalytic mechanism

  • Development of specific inhibitors as potential therapeutic agents against melioidosis

  • Investigation of UbiB's role in different stages of infection and host adaptation

  • Comparative studies of UbiB function across different Burkholderia species to understand evolutionary conservation

  • Integration of UbiB studies with broader research on B. pseudomallei metabolism and virulence

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.