Recombinant Burkholderia pseudomallei Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Biochemical Function

Lgt transfers an sn-1,2-diacylglyceryl moiety from phosphatidylglycerol to the thiol group of a conserved cysteine residue in prolipoproteins, forming a thioether bond. This modification is essential for:

  • Membrane anchoring of lipoproteins .

  • Virulence: Proper localization of virulence-associated lipoproteins in B. pseudomallei .

  • Cell envelope integrity: Mutations in lgt disrupt cell division and motility in related Burkholderia species .

3.1. Mechanistic Studies

Recombinant Lgt is used to investigate:

  • Enzyme kinetics: Substrate specificity and inhibition assays .

  • Lipoprotein maturation: Role in B. pseudomallei pathogenesis .

3.2. Therapeutic Development

  • Antibiotic targeting: Lgt is absent in humans, making it a candidate for narrow-spectrum antibiotics .

  • Vaccine adjuvants: Lipoproteins modified by Lgt may enhance immune responses .

3.3. Diagnostic Tools

  • ELISA kits: Commercial recombinant Lgt is used to detect antibodies in melioidosis patients .

Comparative Analysis

FeatureB. pseudomallei LgtE. coli Lgt
EssentialityLikely essentialEssential
Catalytic ResiduesAsp343 (predicted) Asp129, Ser123
Subcellular LocalizationInner membraneInner membrane

Key Research Findings

  • Genetic conservation: lgt is highly conserved across Burkholderia species, including B. multivorans and B. thailandensis .

  • Structural insights: The catalytic site of Lgt contains a conserved aspartate residue critical for activity, as shown in B. pseudomallei homologs .

  • Immune modulation: Lipoproteins processed by Lgt activate Toll-like receptors (TLRs), contributing to inflammatory responses in melioidosis .

Future Directions

  • Crystallography: Solving the 3D structure of B. pseudomallei Lgt to guide drug design.

  • High-throughput screening: Identifying Lgt inhibitors using recombinant protein libraries.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please indicate them during order placement. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributor for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1 and 1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
lgt; BURPS1106A_1030; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-296
Protein Length
full length protein
Species
Burkholderia pseudomallei (strain 1106a)
Target Names
lgt
Target Protein Sequence
MIIHPNFDPVAIHLGPLAVRWYGLMYLVGFILAIVVGRLRLKLPHVAAQGWSAKDIDDMM FYGVLGVVLGGRLGYVLFYKAGYYFSHPLDIFRVWEGGMSFHGGFLGVTLAMALFAWQRK RHWLEVTDFVAPMVPTGLAAGRLGNFINGELWGRVTSPDAPWAMLFPGASRDDAAWLAAH QDIAAKWNLNEVFLSHQMLPRHPSQLYEIALEGIALFFVLWFFSRKPRPMGAISALFLIG YGAARFTVEFAREPDDFLGLLTFGLSMGQWLSLPMIVAGVLMMIWAYRRGGVAKQA
Uniprot No.

Target Background

Function
Catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the formation of mature lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Prolipoprotein diacylglyceryl transferase (lgt) and what is its role in Burkholderia pseudomallei?

Prolipoprotein diacylglyceryl transferase (lgt) is an essential enzyme in bacterial lipoprotein biosynthesis that catalyzes the transfer of a diacylglyceryl moiety from phosphatidylglycerol to the sulfhydryl group of the conserved cysteine residue in the lipobox motif of prolipoproteins. This post-translational modification is crucial for anchoring lipoproteins to the bacterial membrane, affecting various cellular functions including cell envelope integrity, nutrient acquisition, stress responses, and virulence. In B. pseudomallei, properly processed lipoproteins contribute significantly to pathogenesis through their roles in adhesion, invasion, and immune modulation, making lgt an attractive target for therapeutic intervention .

How does the structure of lgt influence its function in B. pseudomallei?

The structure of B. pseudomallei lgt features multiple transmembrane domains with a catalytic domain that contains conserved histidine and tyrosine residues essential for enzymatic activity. Similar to other bacterial lytic transglycosylases such as LtgG (BPSL3046), the catalytic mechanism likely depends on specific amino acid residues in the active site that coordinate substrate binding and catalysis . Structural studies suggest that lgt operates through a ping-pong mechanism where the diacylglyceryl moiety is first transferred to an enzyme nucleophile before transfer to the prolipoprotein substrate. Mutations in the catalytic domain significantly impact bacterial virulence and survival, as observed with other essential enzymes in B. pseudomallei .

What genomic characteristics influence lgt expression and function in B. pseudomallei?

The genomic context of lgt in B. pseudomallei reveals important regulatory elements that respond to environmental cues including temperature, nutrient availability, and host factors. The high GC content (approximately 68%) of the B. pseudomallei genome affects codon usage and potentially influences translation efficiency of lgt . Comparative genomic analyses show that while the catalytic domains of lgt are highly conserved across Burkholderia species, regulatory regions show greater variability, likely reflecting adaptation to different ecological niches. Evidence suggests that lateral genetic transfer events have shaped the evolution of genes surrounding lgt, though the core enzyme function remains conserved due to its essential role in bacterial physiology .

What expression systems are most effective for producing recombinant B. pseudomallei lgt?

Successful expression of B. pseudomallei lgt requires specialized systems to overcome challenges associated with membrane proteins:

Expression SystemAdvantagesLimitationsOptimized Conditions
E. coli BL21(DE3)Widely available, high yieldsPotential toxicity16-18°C induction, 0.1-0.5 mM IPTG
E. coli C43(DE3)Better for toxic membrane proteinsLower yields20°C induction, overnight expression
Cell-free systemsAvoids toxicity issuesHigher cost, complex setupSupplementation with lipids and detergents
B. thailandensisNative-like foldingBSL-2 containment neededInducible promoters, 30°C growth

Fusion partners such as His6, MBP, or SUMO tags enhance solubility and facilitate purification. Expression vectors with tightly regulated promoters minimize basal expression toxicity. Codon optimization for the expression host can significantly improve yields, particularly given the high GC content of B. pseudomallei genes .

What purification strategies maintain structural integrity and activity of recombinant lgt?

Purification of active B. pseudomallei lgt requires careful consideration of detergent choice and buffer conditions to maintain the native membrane environment:

  • Membrane isolation: Differential centrifugation followed by membrane fractionation using sucrose gradients.

  • Solubilization: Screening multiple detergents is crucial, with n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) often providing optimal results at concentrations of 1% for extraction and 0.05-0.1% for purification buffers.

  • Chromatography sequence: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin followed by size exclusion chromatography using Superdex 200 in buffers containing appropriate detergents.

  • Buffer composition: Including glycerol (10-20%), reducing agents (1-5 mM DTT or TCEP), and appropriate salt concentration (300-500 mM NaCl) enhances stability.

  • Lipid supplementation: Addition of E. coli polar lipid extract (0.01-0.05 mg/mL) during purification maintains enzymatic activity by preserving the lipid microenvironment .

What enzymatic assay methods effectively evaluate B. pseudomallei lgt activity?

Multiple complementary approaches can assess the enzymatic activity of purified recombinant lgt:

  • Radiolabeled assays: Using [³H]-labeled phosphatidylglycerol substrates and synthetic peptides containing the lipobox motif, followed by thin-layer chromatography separation and scintillation counting for quantification.

  • FRET-based assays: Employing synthetic peptide substrates with fluorescence resonance energy transfer pairs that change emission properties upon diacylglyceryl transfer.

  • Mass spectrometry assays: LC-MS/MS analysis directly detecting substrate-to-product conversion, providing both qualitative and quantitative measurements without requiring radioactive materials.

  • Malachite green phosphate detection: A colorimetric method measuring the release of phosphate during the transferase reaction.

  • In vivo complementation: Expressing B. pseudomallei lgt in conditional E. coli lgt mutants to assess functional complementation through restoration of growth and membrane integrity .

How does lgt contribute to B. pseudomallei virulence mechanisms?

The contribution of lgt to B. pseudomallei virulence occurs through multiple pathways:

  • Membrane integrity: Properly processed lipoproteins maintain cell envelope stability under host-imposed stresses, similar to the function of lytic transglycosylases like LtgG that contribute to cellular morphology and division .

  • Immune evasion: Lipoproteins processed by lgt modulate host immune responses, particularly through interaction with Toll-like receptor 2 (TLR2), influencing inflammatory cytokine production.

  • Intracellular survival: Several lipoproteins are essential for survival within macrophages and escape from phagolysosomes, with mechanisms similar to those employed by BopA and BipD for phagosomal escape .

  • Nutrient acquisition: Many lipoproteins function as substrate-binding proteins in ABC transporters essential for bacterial survival in nutrient-limited host environments.

  • Secretion system function: Properly processed lipoproteins contribute to the assembly and function of Type III and Type VI secretion systems, which are critical virulence determinants in B. pseudomallei .

What experimental models are most appropriate for studying lgt in B. pseudomallei infection?

Multiple experimental models provide complementary insights into lgt function:

Model TypeSpecific ModelsApplicationsReadouts
Cell CultureRAW264.7 macrophages, A549 epithelial cellsInvasion, intracellular survivalCFU counting, immunofluorescence
Mouse ModelsBALB/c (acute), C57BL/6 (chronic)In vivo virulence assessmentSurvival, organ bacterial burden
Alternative ModelsGalleria mellonella larvaePreliminary virulence screeningSurvival, melanization
Ex vivoPrecision-cut lung slicesTissue architecture responsesCytokine profiles, histopathology

When designing experiments with conditional lgt mutants, researchers should consider using inducible systems rather than complete gene deletion, as lgt is likely essential for bacterial viability. Careful controls are needed to distinguish direct effects on virulence from growth defects .

How does B. pseudomallei lgt activity compare with that in other bacterial pathogens?

Comparative analysis reveals both conservation and specialization of lgt across bacterial species:

  • Core mechanism: The catalytic mechanism of lgt is highly conserved across Gram-negative bacteria, with similar substrate recognition of the lipobox motif.

  • Substrate specificity: B. pseudomallei lgt processes a unique set of lipoproteins compared to other pathogens, reflecting its specific virulence mechanisms and environmental adaptations.

  • Inhibitor sensitivity: Studies suggest differences in inhibitor binding pockets between B. pseudomallei lgt and homologs in other bacteria, potentially allowing for selective targeting.

  • Regulatory differences: The regulation of lgt expression shows species-specific patterns, with B. pseudomallei demonstrating distinctive responses to environmental stresses relevant to its soil saprophyte and intracellular pathogen lifestyles.

  • Genetic context: Unlike some bacteria where lgt is part of an operon, B. pseudomallei lgt appears to be independently regulated, allowing for fine-tuned expression in response to different environmental cues .

How do genomic approaches inform our understanding of lgt evolution in B. pseudomallei?

Genomic analyses provide critical insights into lgt evolution:

What approaches can identify and characterize inhibitors of B. pseudomallei lgt?

Multiple complementary approaches can identify potential lgt inhibitors:

  • Structure-based virtual screening: Utilizing homology models or crystal structures (similar to the approach used for LtgG) to dock virtual compound libraries against the active site or allosteric regions .

  • High-throughput biochemical assays: Adapting enzymatic assays to microplate format for screening chemical libraries, with counter-screens against mammalian enzymes to ensure selectivity.

  • Fragment-based screening: Identifying small chemical fragments that bind to lgt, which can be elaborated into more potent and selective inhibitors through medicinal chemistry.

  • Peptidomimetics: Designing inhibitors based on the structure of the lipobox motif in natural substrates, incorporating non-hydrolyzable analogs of the reaction transition state.

  • Natural product screening: Evaluating microbial extracts, particularly from soil organisms that may naturally compete with Burkholderia species in their environmental niche.

Promising candidates undergo detailed characterization through enzyme kinetics, binding studies using biophysical methods, and evaluation in cellular infection models .

How do modifications to lgt affect antibiotic susceptibility in B. pseudomallei?

The relationship between lgt function and antibiotic susceptibility involves multiple mechanisms:

  • Membrane permeability: Altered lipoprotein processing affects membrane integrity, potentially increasing permeability to hydrophilic antibiotics. This phenomenon could be exploited to enhance the efficacy of existing antibiotics like cephalosporins that typically show limited activity against B. pseudomallei .

  • Efflux pump assembly: Several lipoproteins contribute to the assembly and function of efflux pumps. Modulation of lgt activity may therefore affect the export of various antibiotics, potentially increasing intracellular accumulation and efficacy.

  • Stress responses: Properly processed lipoproteins are involved in stress response pathways. Inhibiting lgt may compromise adaptation to antibiotic-induced stress, potentially creating synergistic opportunities with conventional antibiotics.

  • Biofilm formation: Lipoproteins contribute to biofilm matrix formation and stability. Targeting lgt may disrupt biofilms, rendering bacteria more susceptible to antibiotics that typically show reduced activity against biofilm-associated cells .

  • Persister formation: Evidence suggests links between membrane stress and persister cell formation. Modulation of lgt activity might affect the frequency of persister formation in response to antibiotic exposure .

What biosafety considerations apply when working with recombinant B. pseudomallei proteins?

Working with B. pseudomallei components requires careful attention to biosafety:

  • Regulatory classification: B. pseudomallei is classified as a Tier 1 Select Agent in many countries, requiring specialized facilities and approvals for work with live organisms .

  • Risk mitigation strategies:

    • Express recombinant proteins in surrogate systems (E. coli, B. thailandensis)

    • Use attenuated strains when live organisms are required

    • Implement validated decontamination protocols specific to materials and equipment

  • Facility requirements:

    • BSL-3 containment for work with live B. pseudomallei

    • Dedicated equipment and validated inactivation procedures

    • Proper waste management protocols

  • Personnel considerations:

    • Specialized training for BSL-3 practices

    • Medical surveillance programs

    • Incident response planning

  • Alternative approaches:

    • B. thailandensis as a BSL-2 surrogate organism

    • Recombinant expression of lgt in heterologous hosts

    • Computational approaches to complement experimental work

How can researchers address protein folding and stability challenges with recombinant lgt?

Membrane proteins like lgt present significant challenges for recombinant expression and purification:

  • Expression optimization:

    • Lower induction temperature (16-18°C) and inducer concentration

    • Co-expression of molecular chaperones (GroEL/ES, DnaK/J)

    • Addition of chemical chaperones (glycerol, arginine) to culture medium

  • Solubilization strategies:

    • Systematic screening of detergents for extraction and purification

    • Detergent-lipid mixtures to better mimic native membrane environment

    • Nanodiscs or amphipols as alternatives to conventional detergents

  • Stability assessment methods:

    • Differential scanning fluorimetry to identify stabilizing conditions

    • Size exclusion chromatography with multi-angle light scattering to monitor aggregation

    • Limited proteolysis to identify stable domains

  • Structural characterization approaches:

    • X-ray crystallography with lipidic cubic phase for membrane proteins

    • Cryo-electron microscopy for structure determination without crystallization

    • Hydrogen-deuterium exchange mass spectrometry for dynamic information

What are effective strategies for developing specific antibodies against B. pseudomallei lgt?

Developing specific antibodies against membrane proteins like lgt requires specialized approaches:

  • Antigen design strategies:

    • Hydrophilic loop regions for targeting accessible epitopes

    • Peptide antigens corresponding to surface-exposed domains

    • Recombinant soluble domains expressed as fusion proteins

  • Immunization protocols:

    • Multiple small doses rather than fewer large doses

    • Use of adjuvants specifically effective for membrane protein antigens

    • Prime-boost strategies with different antigen presentations

  • Screening and validation:

    • ELISA against peptide and recombinant protein

    • Western blotting under non-denaturing conditions

    • Immunofluorescence microscopy with intact bacteria

    • Functional assays to assess antibody neutralization potential

  • Applications of antibodies:

    • Localization studies in infected cells

    • Immunoprecipitation of protein complexes

    • Flow cytometry for detection of surface-exposed epitopes

    • Potential therapeutic development for passive immunization

How can lgt research contribute to vaccine development against B. pseudomallei?

Research on B. pseudomallei lgt offers multiple avenues for vaccine development:

  • Attenuated vaccine strains:

    • Conditional lgt mutants as potential live attenuated vaccines

    • Strains with modified lgt activity producing altered lipoproteins with enhanced immunogenicity

    • Balanced attenuation to ensure safety while maintaining protective immunity

  • Subunit vaccine approaches:

    • Lipoproteins processed by lgt as vaccine antigens

    • Recombinant lipoproteins with optimized adjuvant properties

    • Multi-epitope constructs incorporating immunodominant regions from multiple lipoproteins

  • Adjuvant development:

    • Synthetic lipopeptides based on natural lgt substrates as built-in adjuvants

    • Modulation of Toll-like receptor 2 responses through engineered lipoprotein derivatives

    • Liposome formulations incorporating purified lipoproteins

  • Cross-protection potential:

    • Identification of conserved lipoprotein epitopes across Burkholderia species

    • Evaluation of cross-protection against B. mallei and other related pathogens

    • Development of broadly protective formulations targeting multiple species

What diagnostic applications could emerge from B. pseudomallei lgt research?

Research on lgt and its substrates can advance melioidosis diagnostics:

  • Antigen detection methods:

    • Immunoassays targeting lgt-processed lipoproteins in patient samples

    • Lateral flow tests for point-of-care diagnosis in endemic regions

    • Multiplexed detection of several lipoproteins for improved sensitivity

  • Molecular diagnostics:

    • PCR assays targeting lgt and substrate genes with species-specific primers

    • CRISPR-Cas-based nucleic acid detection methods

    • Next-generation sequencing approaches to detect B. pseudomallei in complex samples

  • Serology improvements:

    • ELISAs detecting patient antibodies against multiple lipoproteins

    • Protein microarrays profiling responses to multiple antigens simultaneously

    • Distinguishing acute from chronic or past infections through antibody profiles

  • Performance characteristics:

    • Enhanced sensitivity for early detection before clinical manifestation

    • Improved specificity to distinguish from related Burkholderia species

    • Rapid results to facilitate timely treatment decisions

How might lgt inhibitors be developed as novel therapeutics against B. pseudomallei?

Development of lgt inhibitors as therapeutics involves several considerations:

  • Target validation:

    • Genetic studies confirming essentiality in relevant infection models

    • Demonstration of attenuated virulence with reduced lgt function

    • Evaluation of potential for resistance development

  • Chemical starting points:

    • Structure-based design utilizing crystal structures or homology models

    • High-throughput screening of diverse chemical libraries

    • Natural product-derived scaffolds with activity against bacterial lipid metabolism

  • Medicinal chemistry optimization:

    • Structure-activity relationship studies to improve potency and selectivity

    • Pharmacokinetic optimization for appropriate tissue distribution

    • Toxicity mitigation through rational design

  • Combination therapy potential:

    • Synergy testing with conventional antibiotics

    • Sequential therapy protocols to prevent resistance

    • Host-directed therapy combinations addressing both bacterial and host factors

  • Special delivery considerations:

    • Nanomaterial formulations for improved biodistribution

    • Inhaled formulations for pulmonary melioidosis

    • Penetration enhancers for biofilm-associated infections

What emerging technologies could advance our understanding of B. pseudomallei lgt?

Several cutting-edge technologies promise to deepen our understanding of lgt function:

  • CRISPR-Cas9 applications:

    • CRISPRi for tunable gene knockdown rather than complete knockout

    • Base editing for introducing specific mutations without double-strand breaks

    • CRISPR-mediated recombination for precise genomic modifications

  • Advanced imaging:

    • Super-resolution microscopy to visualize lgt localization and dynamics

    • Correlative light and electron microscopy to connect function with ultrastructure

    • Live-cell imaging with fluorescent lipid analogs to track lipoprotein processing in real-time

  • Systems biology approaches:

    • Multi-omics integration connecting lgt function to global cellular processes

    • Network analysis identifying key interactions and dependencies

    • Machine learning to predict substrate specificity and inhibitor binding

  • Structural biology innovations:

    • Cryo-electron tomography of bacterial cells to visualize lgt in native context

    • Single-particle analysis of membrane protein complexes

    • Integrative structural biology combining multiple data types

How might environmental factors influence lgt function and evolution in B. pseudomallei?

Environmental influences on lgt represent an important frontier in research:

  • Soil microenvironment effects:

    • Influence of soil composition on lgt expression and substrate range

    • Competitive interactions with other soil microorganisms

    • Adaptation to varying nutrient availability and stresses

  • Host transition adaptations:

    • Changes in lgt expression and activity during transition from environment to host

    • Different requirements for lipoprotein processing in environmental versus pathogenic lifestyles

    • Temperature-dependent regulation of lgt and its substrates

  • Biofilm-specific considerations:

    • Altered lipoprotein processing in biofilm versus planktonic states

    • Contribution of lgt-processed proteins to biofilm matrix and structure

    • Potential for targeting biofilm-specific functions of lipoproteins

  • Climate change implications:

    • Effects of changing temperature and rainfall patterns on B. pseudomallei distribution

    • Potential emergence in new geographical regions with different selective pressures

    • Evolutionary adaptations to changing environmental conditions

What interdisciplinary approaches could accelerate translation of lgt research to clinical applications?

Interdisciplinary collaboration can accelerate clinical translation:

  • Computational-experimental integration:

    • Molecular dynamics simulations guiding experimental design

    • Machine learning prediction of substrate specificity and inhibitor binding

    • Systems pharmacology modeling for combination therapy optimization

  • Chemistry-biology interface:

    • Fragment-based drug discovery targeting lgt

    • Click chemistry approaches for activity-based protein profiling

    • Development of chemical probes for mechanistic studies

  • Clinical-basic science partnerships:

    • Patient isolate characterization to understand lgt variation in clinical settings

    • Correlation of lgt sequence variants with clinical outcomes

    • Biomarker development through translational research pipelines

  • One Health approaches:

    • Ecological surveillance integrating environmental, animal, and human health

    • Monitoring lgt evolution across environmental and clinical settings

    • Developing interventions applicable across the human-animal-environment interface

  • Diagnostic-therapeutic combination:

    • Theranostic approaches combining detection and targeted inhibition

    • Companion diagnostics to guide treatment selection

    • Point-of-care testing integrated with treatment algorithms

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.