Recombinant Burkholderia pseudomallei Protein CrcB homolog (crcB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them during order placement. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary based on the purchase method and location. For specific delivery estimates, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipment, please inform us in advance, as additional charges will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
It is recommended to briefly centrifuge the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
crcB; BPSL2638; Putative fluoride ion transporter CrcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-128
Protein Length
full length protein
Species
Burkholderia pseudomallei (strain K96243)
Target Names
crcB
Target Protein Sequence
MFYSIVAIFVGAGFGALLRWFLSIGLNALLPEVPLGTLASNLIGGYLIGIAVVAFATRAG LPPEWRLFVITGFMGGLTTFSTYSVEVMTHAVQGEFGWALAVAALHLIGSFTLTGLGMWT ARAWLAPA
Uniprot No.

Target Background

Function
CrcB plays a critical role in reducing fluoride concentration within the cell, thereby mitigating its toxicity.
Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Burkholderia pseudomallei Protein CrcB homolog (crcB) and what is its significance?

B. pseudomallei Protein CrcB homolog is a membrane protein encoded by the crcB gene (e.g., BPSL2638 in strain K96243) . It belongs to a family of membrane proteins involved in fluoride ion transport across cellular membranes. While the specific function of CrcB in B. pseudomallei has not been fully characterized, in other bacteria, CrcB proteins function as fluoride channels or transporters that export fluoride ions from the cytoplasm. This function protects bacteria from the toxic effects of environmental fluoride.

The significance of studying this protein stems from B. pseudomallei's remarkable environmental persistence (surviving in distilled water for 16 years) and its classification as a Tier 1 select agent by the CDC due to its bioterrorism potential . Understanding CrcB's role may provide insights into this pathogen's environmental adaptability and potentially identify new therapeutic targets.

What are the optimal experimental conditions for handling recombinant CrcB protein?

Based on product information from multiple sources, the following conditions are recommended for optimal handling of recombinant CrcB protein:

ParameterRecommended ConditionNotes
Storage temperature-20°C or -80°C for extended storagePrimary storage condition
Buffer compositionTris-based buffer with 50% glycerolOptimized for protein stability
Working temperature4°CFor short-term use (up to one week)
Freezing/thawingMinimize cyclesRepeated freezing and thawing not recommended
Purification approachAffinity chromatographyOften using His-tag systems
Expression systemsE. coli-based systemsCommon for recombinant production

Source: Information compiled from products described in

What experimental approaches can be used to characterize CrcB homolog function in B. pseudomallei?

To characterize the function of CrcB homolog in B. pseudomallei, researchers should consider a multifaceted approach:

  • Gene knockout studies: Generate markerless deletion mutants (ΔcrcB) using approaches similar to those employed for other B. pseudomallei genes such as regA . Compare the phenotypes of wild-type and mutant strains under various conditions, especially under fluoride exposure. Complementation with the wild-type gene should restore the phenotype if CrcB is responsible.

  • Fluoride transport assays: Develop assays using fluoride-sensitive electrodes or fluorescent indicators to measure fluoride transport. Compare transport activity between membrane vesicles prepared from wild-type and ΔcrcB mutants.

  • Protein localization studies: Use fluorescently tagged CrcB versions to determine subcellular localization. Confirm membrane localization through cell fractionation and Western blot analysis.

  • Transcriptomic analysis: Perform RNA-seq to identify genes co-regulated with crcB and to determine environmental conditions that affect its expression. This approach was successful in characterizing the RegAB regulon in B. pseudomallei .

  • Intracellular survival assays: Since B. pseudomallei is an intracellular pathogen that multiplies within macrophages , compare intracellular survival of wild-type and ΔcrcB mutants in RAW264.7 cells using approaches similar to those described for BPSS1996 .

How can the structure of B. pseudomallei CrcB homolog be determined experimentally?

Determining the structure of membrane proteins like CrcB presents unique challenges. A comprehensive structural biology approach should include:

  • X-ray crystallography:

    • Express and purify large quantities (>5mg) of recombinant CrcB

    • Screen for detergents that maintain protein stability

    • Identify crystallization conditions through automated screening

    • Optimize crystals for high-resolution diffraction

    • Solve phase problem using heavy atom derivatives or molecular replacement

  • Cryo-electron microscopy (cryo-EM):

    • Particularly suitable for membrane proteins that resist crystallization

    • Purify CrcB in detergent micelles or reconstitute into nanodiscs

    • Vitrify samples and collect images with high-end electron microscopes

    • Process data using single-particle analysis software

    • Generate 3D reconstructions and build atomic models

  • Nuclear Magnetic Resonance (NMR):

    • Express isotopically labeled CrcB (13C, 15N)

    • Optimize sample conditions for solution NMR

    • Collect multidimensional spectra for resonance assignments

    • Generate distance restraints from NOE experiments

    • Build structural models using computational approaches

  • Computational prediction:

    • Use AlphaFold or similar artificial intelligence approaches

    • Validate predictions through experimental data

    • Refine models with molecular dynamics simulations

For transmembrane proteins like CrcB, specialized approaches such as lipid cubic phase crystallization may be particularly effective. Structural information would facilitate understanding how CrcB interacts with fluoride ions and potential inhibitor design.

How can protein-protein interactions of CrcB be identified and characterized?

Identifying protein-protein interactions involving CrcB requires specialized approaches due to its membrane localization:

  • Co-immunoprecipitation with mass spectrometry:

    • Generate specific antibodies against CrcB or use tagged versions

    • Solubilize membranes with suitable detergents

    • Precipitate CrcB and associated proteins

    • Identify interacting partners through LC-MS/MS

    • Validate interactions through reciprocal pull-downs

  • Proximity-based labeling:

    • Generate fusions of CrcB with BioID or APEX2 enzymes

    • Express in B. pseudomallei under native conditions

    • Induce proximity labeling of neighboring proteins

    • Purify biotinylated proteins and identify by mass spectrometry

  • Bacterial two-hybrid system:

    • Adapt membrane-specific bacterial two-hybrid systems

    • Screen genomic libraries to identify interaction partners

    • Validate positive hits with targeted experiments

  • Crosslinking mass spectrometry:

    • Use membrane-permeable crosslinkers that stabilize transient interactions

    • Identify crosslinked peptides by specialized MS approaches

    • Map interaction interfaces with high spatial resolution

  • FRET-based approaches:

    • Generate fluorescent protein fusions to CrcB and candidate interactors

    • Measure energy transfer as indication of protein proximity

    • Perform in living bacterial cells to maintain native context

When working with B. pseudomallei, biosafety considerations are paramount as it is classified as a Tier 1 select agent . Researchers must work in appropriate containment facilities or consider using closely related but less pathogenic species like B. thailandensis as model systems for initial studies.

How might CrcB contribute to B. pseudomallei pathogenesis and environmental survival?

While direct evidence linking CrcB to B. pseudomallei pathogenesis is limited in the available literature, several hypotheses can be formulated based on bacterial pathophysiology:

  • Environmental persistence: B. pseudomallei demonstrates remarkable environmental persistence, surviving in distilled water for 16 years and resisting various harsh conditions including nutrient deficiency and extreme pH . If CrcB functions as a fluoride exporter, it may contribute to survival in environments with varying fluoride concentrations.

  • Intracellular adaptation: B. pseudomallei is an intracellular pathogen that multiplies within macrophages . The intracellular environment presents unique ionic challenges, and CrcB might participate in maintaining ion homeostasis during infection.

  • Stress response: CrcB could be part of a broader stress response network. The RegAB two-component system has been identified as a master regulator of anaerobic metabolism in B. pseudomallei , and it's possible that CrcB expression is regulated as part of stress adaptation pathways.

  • Biofilm formation: Membrane proteins often contribute to bacterial surface properties. CrcB might influence biofilm formation, which is important for environmental persistence and antimicrobial resistance.

To test these hypotheses, researchers should:

  • Compare the virulence of wild-type and ΔcrcB mutants in animal models

  • Assess intracellular survival in macrophage infection models

  • Examine expression patterns under various environmental stresses

  • Investigate biofilm formation capabilities of mutant strains

How can CrcB homolog be evaluated as a potential therapeutic target for melioidosis?

Evaluating CrcB as a therapeutic target should follow a systematic approach:

  • Target validation:

    • Demonstrate essentiality or significant contribution to virulence

    • Show attenuated virulence of ΔcrcB mutants in animal models

    • Determine if chemical inhibition of CrcB affects bacterial viability

  • Druggability assessment:

    • Analyze the structure for potential binding pockets

    • Perform computational docking studies with virtual compound libraries

    • Develop high-throughput screening assays for inhibitor identification

  • Immunological evaluation:

    • Test if recombinant CrcB elicits protective immunity in animal models

    • Evaluate antibody responses in melioidosis patients

    • Assess potential as a vaccine component

  • Diagnostic potential:

    • Determine if anti-CrcB antibodies are detectable in patient sera

    • Develop ELISA assays similar to those used for other B. pseudomallei proteins

    • Evaluate sensitivity and specificity for melioidosis diagnosis

Melioidosis presents diagnostic challenges, with current methods showing low sensitivity (25-44%) but high specificity (93-98%) . If CrcB proves immunogenic, it could potentially contribute to improved diagnostic approaches.

How does B. pseudomallei CrcB compare to homologs in other bacterial species?

A comparative analysis of CrcB across bacterial species provides evolutionary and functional insights:

  • Sequence conservation:

    • CrcB proteins are highly conserved within the Burkholderia genus

    • The protein sequence is nearly identical (>99% identity) between B. pseudomallei strains

    • High similarity is likely with homologs in B. thailandensis and B. mallei

  • Genomic context:

    • In many bacteria, crcB genes are often found near genes involved in fluoride resistance

    • Analysis of the genomic neighborhood can provide functional clues

    • Proteogenomic analysis approaches similar to those used for other Burkholderia species would be informative

  • Functional divergence:

    • While core fluoride transport function is likely conserved, species-specific adaptations may exist

    • Differences in regulation and expression patterns might reflect ecological niches

    • B. pseudomallei's remarkable environmental persistence suggests potential unique adaptations

  • Structural comparison:

    • Structural modeling based on solved structures from other bacteria

    • Identification of conserved versus variable regions

    • Mapping of potential species-specific functional sites

Such comparative analyses would not only advance basic understanding of bacterial ion transport but might also identify B. pseudomallei-specific features that could be exploited for targeted therapeutic development.

What are the major challenges in expressing and purifying membrane proteins like CrcB?

Membrane proteins present specific challenges throughout the experimental pipeline:

ChallengeDescriptionSolutions
Low expression levelsMembrane proteins often express poorly in heterologous systems- Use specialized expression strains (C41/C43 E. coli)
- Optimize codon usage
- Test different fusion tags
- Use inducible promoters with tight regulation
Protein toxicityOverexpression can disrupt host membranes- Use lower induction temperatures
- Reduce inducer concentration
- Express in cell-free systems
Proper membrane insertionEnsuring correct folding and membrane integration- Co-express with chaperones
- Use specialized secretion systems
- Express as GFP fusions to monitor folding
SolubilizationExtracting protein from membranes while maintaining structure- Screen multiple detergents systematically
- Use mild detergents (DDM, LMNG)
- Consider native nanodiscs or SMALPs
Purification efficiencyLower yields compared to soluble proteins- Optimize affinity tags and cleavage sites
- Implement two-step purification strategies
- Minimize purification steps
Protein stabilityMaintaining function outside the membrane environment- Include stabilizing lipids in buffers
- Optimize buffer composition
- Consider protein engineering for stability
Functional assessmentVerifying activity of purified protein- Develop robust activity assays
- Reconstitute in proteoliposomes
- Use biophysical techniques to verify folding

For CrcB specifically, researchers should:

  • Optimize expression in E. coli strains designed for membrane proteins

  • Screen multiple detergents for extraction efficiency and protein stability

  • Consider using fluoride-sensitive assays to monitor function throughout purification

  • Utilize tags that facilitate both purification and detection (His-SUMO has been used successfully )

How can we develop robust assays to measure CrcB function?

Developing functional assays for CrcB requires consideration of its putative role as a fluoride transporter:

  • Fluoride electrode-based assays:

    • Reconstitute purified CrcB into proteoliposomes

    • Create a fluoride gradient across the membrane

    • Monitor fluoride efflux using fluoride-selective electrodes

    • Compare transport rates between wild-type and mutant versions

  • Fluorescence-based assays:

    • Use fluoride-sensitive fluorescent dyes

    • Develop cell-based assays with E. coli expressing CrcB

    • Measure fluorescence changes upon fluoride addition

    • High-throughput compatible for inhibitor screening

  • Radioactive flux assays:

    • Use 18F-labeled fluoride to track transport

    • Measure accumulation or efflux in cells or vesicles

    • Quantify with scintillation counting

  • Growth-based functional assays:

    • Express CrcB in fluoride-sensitive E. coli strains

    • Assess growth rescue under fluoride stress

    • Compare different CrcB variants

    • Adaptable for high-throughput screening

  • Electrophysiological approaches:

    • Reconstitute CrcB in planar lipid bilayers

    • Record channel activity using patch-clamp techniques

    • Characterize ion selectivity and gating properties

Each approach has advantages and limitations, and combining multiple methods provides the most robust functional characterization.

What biosafety considerations are important when working with B. pseudomallei proteins?

Working with B. pseudomallei and its proteins requires strict adherence to biosafety guidelines:

  • Regulatory classification:

    • B. pseudomallei is classified as a Tier 1 select agent by the CDC

    • Work with live organisms requires BSL-3 containment

    • Special security measures are required to safeguard against theft, loss, or release

  • Recombinant protein considerations:

    • Recombinant proteins expressed in E. coli generally present lower risk

    • Risk assessment should consider potential toxicity or immunogenicity

    • Local biosafety committee approval is required

  • Laboratory safeguards:

    • Proper labeling of samples to avoid lab exposure

    • Use of appropriate personal protective equipment

    • Implementation of standard operating procedures for handling

    • Proper decontamination and waste disposal protocols

  • Alternative approaches:

    • Use closely related but less pathogenic species (B. thailandensis) for initial studies

    • Consider synthetic biology approaches with minimal gene fragments

    • Employ computational methods before experimental work

  • Post-exposure protocols:

    • Establish clear procedures for potential exposures

    • Post-exposure prophylaxis with trimethoprim/sulfamethoxazole for 21 days is recommended for high-risk exposures

    • Medical surveillance for exposed personnel

The CDC provides detailed guidelines for working with B. pseudomallei that should be consulted before initiating any research with this organism or its components.

What are the current knowledge gaps regarding CrcB homolog in B. pseudomallei?

Despite the availability of recombinant CrcB protein for research purposes, significant knowledge gaps remain:

  • Fundamental function:

    • Direct experimental confirmation that B. pseudomallei CrcB functions as a fluoride transporter

    • Kinetic characterization of transport activity

    • Identification of essential residues for function

  • Structural information:

    • No high-resolution structure of B. pseudomallei CrcB is currently available

    • Structural insights would facilitate understanding of transport mechanism

    • Structure would enable rational drug design approaches

  • Regulation mechanisms:

    • How crcB expression is regulated in B. pseudomallei

    • Whether it's part of regulons controlled by master regulators like RegAB

    • Environmental signals that modulate expression

  • Role in pathogenesis:

    • Contribution to virulence or host colonization

    • Impact on intracellular survival

    • Potential as a therapeutic target

  • Immunological significance:

    • Whether CrcB elicits immune responses during infection

    • Potential as a diagnostic or vaccine component

    • Cross-reactivity with human proteins

Addressing these gaps requires interdisciplinary approaches combining molecular genetics, biochemistry, structural biology, and immunology.

How can emerging technologies advance our understanding of CrcB function?

Emerging technologies offer new opportunities to study challenging proteins like CrcB:

  • Cryo-electron microscopy advances:

    • Recent developments in single-particle cryo-EM enable high-resolution structures of smaller membrane proteins

    • Direct visualization of CrcB in different conformational states

    • Potential to observe ion binding and transport

  • CRISPR-based approaches:

    • Precise genome editing in B. pseudomallei or model organisms

    • CRISPRi for conditional knockdown studies

    • CRISPRa for overexpression analysis

  • AlphaFold and computational approaches:

    • AI-driven structure prediction increasingly accurate for membrane proteins

    • Virtual screening of potential inhibitors

    • Molecular dynamics simulations of ion transport

  • Single-cell technologies:

    • Single-cell RNA-seq to study heterogeneity in crcB expression

    • Single-cell proteomics to analyze protein levels

    • Correlation with phenotypic outcomes

  • Microfluidic platforms:

    • High-throughput screening of conditions affecting CrcB function

    • Single-cell analysis of bacterial responses

    • Miniaturized assays requiring minimal amounts of purified protein

  • Nanopore technologies:

    • Direct measurement of ion transport through reconstituted CrcB

    • Single-molecule analysis of transport kinetics

    • Real-time monitoring of inhibitor effects

These technologies could transform our understanding of CrcB function and facilitate development of novel therapeutic approaches against melioidosis.

How might understanding CrcB function contribute to broader bacterial physiology knowledge?

Research on B. pseudomallei CrcB has implications beyond this specific protein:

  • Ion homeostasis in bacteria:

    • Contribute to broader understanding of bacterial ion transport mechanisms

    • Insights into how bacteria manage toxic ions in various environments

    • Evolutionary adaptations of ion transport systems

  • Bacterial stress responses:

    • Integration of ion transport with general stress response networks

    • Connection to redox-sensing systems like RegAB

    • Role in adaptation to changing environments

  • Membrane protein biology:

    • Advances in expression, purification, and structural characterization of bacterial membrane proteins

    • Development of broadly applicable methodologies

    • Structure-function relationships in transport proteins

  • Pathogen-host interactions:

    • Understanding how ion homeostasis contributes to bacterial survival in host environments

    • Potential discovery of conserved mechanisms across pathogens

    • New therapeutic targets with broad-spectrum potential

  • Environmental adaptation mechanisms:

    • Insights into how bacteria like B. pseudomallei survive in diverse environments

    • Understanding of persistence mechanisms relevant to environmental health

    • Ecological implications of bacterial adaptation

B. pseudomallei's remarkable environmental persistence and its ability to cause severe disease make it an important model organism for understanding bacterial adaptability. Studies of CrcB and similar proteins contribute to our fundamental understanding of how bacteria thrive in diverse and challenging conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.