Recombinant Burkholderia pseudomallei Translocator protein BipB (bipB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a guideline for your preparations.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
bipB; BURPS668_A2162; Translocator protein BipB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-620
Protein Length
full length protein
Species
Burkholderia pseudomallei (strain 668)
Target Names
bipB
Target Protein Sequence
MSSGVQGGPAAHANAYQTHPLRDAASALGTLSPQAYVDVVSAAQRNFLERMSQLASEQCD AQPAAHDARLDDRPALRAPQERDAPPLGASDTGSRASGAAKLTELLGVLMSVISASSLDE LKQRSDIWNQMSKAAQDNLSRLSDAFQRATDEAKAAADAAEQAAAAAKQAGADAKAADAA VDAAQKRYDDAVKQGLPDDQLQSLKAALEQARQQAGDAHGRADALQADATKKLDAASALA TQARACEQQVDDAVNQATQQYGASASLRTPQSPRLSGAAELTAVLGKLQELISSGNVKEL ESKQKLFTEMQAKREAELQKKSDEYQAQVKKAEEMQKTMGCIGKIVGWVITAVSFAAAAF TGGASLALAAVGLALAVGDEISRATTGVSFMDKLMQPVMDAILKPLMEMISSLITKALVA CGVDQQKAELAGAILGAVVTGVALVAAAFVGASAVKAVASKVIDAMAGQLTKLMDSAIGK MLVQLIEKFSEKSGLQALGSRTATAMTRMRRAIGVEAKEDGMLLANRFEKAGTVMNVGNQ VSQAAGGIVVGVERAKAMGLLADVKEAMYDIKLLGDLLKQAVDAFAEHNRVLAQLMQQMS DAGEMQTSTGKLILRNARAV
Uniprot No.

Target Background

Function
This protein plays a crucial role in bacterium-induced multinucleated giant cell (MNGC) formation resulting from host cell fusion. It also contributes to the intracellular spread of bacteria and the induction of apoptosis in macrophages. BipB likely acts synergistically with other effector proteins to facilitate host cell membrane fusion.
Database Links
Protein Families
Invasin protein B family
Subcellular Location
Secreted. Host membrane.

Q&A

What is BipB and what is its role in B. pseudomallei pathogenesis?

BipB is a translocator protein component of the Type III Secretion System (specifically the Bsa T3SS or T3SS-3) in Burkholderia pseudomallei. It functions as part of the molecular machinery that enables the bacterium to inject effector proteins into host cells during infection. BipB is critical for the intracellular survival, replication, and virulence of B. pseudomallei . The protein shows homology to Salmonella's SipB protein (approximately 15-27% identity) , suggesting functional similarity in facilitating bacterial invasion of host cells and subsequent pathogenesis. In the context of the complete T3SS apparatus, BipB likely works alongside other components to form a functional translocation pore that allows bacterial effectors to cross the host cell membrane.

How conserved is the BipB protein among Burkholderia species?

BipB demonstrates high conservation among Burkholderia pseudomallei and Burkholderia mallei isolates with at least 98% sequence identity, reflecting the close phylogenetic relationship between these species . When compared to the less closely related Burkholderia thailandensis, BipB shows 85-93% identity . This high degree of conservation suggests evolutionary pressure to maintain BipB structure and function, underscoring its importance in bacterial pathogenesis. The conservation pattern aligns with the broader genomic relationship between these Burkholderia species and implies that findings regarding BipB in one species may have relevance across the genus.

What expression systems have been successfully used to produce recombinant BipB protein?

Successful expression of recombinant BipB has been achieved using several systems:

  • The Impact-Twin vectors system (NEB) has been used to express BipB-N (codons 7-277), producing a fusion protein with an N-terminal fusion partner, a Ser-Gly-Gly linker, and a C-terminal polyhistidine tag .

  • The pGEX GST fusion system has been employed to express BipB-N (residues 9-285) .

For purification, techniques include:

  • Negative adsorption to Q-Sepharose resin

  • Adsorption to chitin resin

  • Cleavage from fusion partners to isolate the target protein

These expression systems provide researchers with practical options for producing recombinant BipB for structural studies, immunological assays, and functional analyses.

What are the structural characteristics of BipB protein?

BipB is a 621-residue protein that likely forms a coiled-coil structure similar to its homologs in other bacterial species . The N-terminal domain (BipB-N) has been the focus of many studies due to its stability and immunogenicity. Based on homology with Salmonella SipB, the N-terminal domain is likely involved in interactions with other T3SS components, while the C-terminal portion may participate in membrane insertion and pore formation. Structural studies suggest that like its homolog IpaB from Shigella, BipB's N-terminal domain is stable and can maintain its structure independently of C-terminal regions . The protein's structure enables it to function both as a component of the secretion apparatus and as a translocator of effector proteins across host cell membranes.

How can one optimize detection of native BipB expression in laboratory conditions?

Detection of native BipB expression in laboratory conditions presents significant challenges, as BipB is not readily detectable under standard growth conditions . Based on research findings, the following approaches may improve detection:

  • Environmental triggers: Given that B. pseudomallei undergoes phenotypic switching , exploring various environmental cues such as low pH, low oxygen, or host cell contact may trigger BipB expression.

  • In vivo induction: Consider using co-culture systems with host cells to stimulate T3SS activation.

  • Detection methods:

    • Use highly sensitive Western blot techniques with enhanced chemiluminescence

    • Employ immunoprecipitation to concentrate BipB protein

    • Consider reporter gene fusions to monitor expression

  • Timing of detection: Sample at multiple time points during growth and infection cycles

It's worth noting that researchers have successfully detected BipD (another T3SS component) in engineered Shigella systems, suggesting that heterologous expression systems may be valuable tools for studying BipB function when native expression is difficult to achieve .

What is the relationship between BipB and other T3SS components in B. pseudomallei?

BipB functions within a complex network of T3SS components, with specific interactions that orchestrate secretion and translocation:

  • Interaction with needle tip proteins: By analogy to the Shigella system, BipB likely interacts with BipD (needle tip protein) to regulate secretion. In a BipD mutant, increased levels of both translocators and effectors are secreted into culture supernatant , suggesting BipD controls BipB deployment.

  • Regulatory interactions: The expression and function of BipB may be controlled by regulatory proteins similar to how IpaD interacts with MxiC in Shigella . An equivalent interaction between BipD and BsaP in B. pseudomallei has been proposed , which would indirectly affect BipB function.

  • Component hierarchy:

    ComponentProposed FunctionInteraction with BipB
    BipDNeedle tip proteinControls BipB secretion
    BsaPGatekeeper proteinMay regulate BipB through BipD
    BipCTranslocatorWorks with BipB for pore formation

Understanding these relationships is critical for developing targeted interventions against the T3SS.

What methodological approaches have been used to evaluate BipB as a vaccine candidate?

Evaluation of BipB as a vaccine candidate has involved several methodological approaches:

  • Recombinant protein production: Expression and purification of BipB-N (N-terminal portion) as a candidate antigen .

  • Immunization protocols: Vaccination of experimental animals (mice) with purified recombinant BipB protein .

  • Challenge studies: Assessment of protection by challenging immunized animals with B. pseudomallei and monitoring survival rates .

  • Immune response characterization:

    ParameterMethodTypical Results
    Antibody productionELISAReciprocal endpoint titers ranging from 100 to >12,800 against BipB-N
    Protection efficacySurvival analysisNo significant protection when BipB used alone
    Human seroconversionELISA with melioidosis patient seraPresence of antibodies to BipB, but low diagnostic accuracy in endemic regions
  • Comparative analysis: Evaluation alongside other T3SS components (BipC, BipD) to assess relative immunogenicity and protection .

Research indicates that while BipB can elicit antibody responses, it does not provide significant protection when used as a single-antigen vaccine . This suggests that effective vaccines may require combinations of antigens or alternative approaches.

How does BipB sequence and function compare across different pathogenic bacteria with homologous T3SS components?

BipB shows evolutionary relationships with translocator proteins in other bacterial pathogens, with important functional implications:

  • Sequence homology:

    • Closest match outside Burkholderia is SipB from Salmonella enterica (GenBank accession YP_217804), with limited sequence identity (15-27%)

    • Despite low sequence identity, functional domains appear conserved

  • Functional conservation:

    SpeciesHomologous ProteinSequence IdentityFunctional Similarity
    Salmonella entericaSipB15-27%Cell invasion, pore formation
    Shigella flexneriIpaBSimilar to SipBCell invasion, pore formation
  • Structural implications: The N-terminal domain of BipB, like that of SipB, is resistant to proteolysis, suggesting a stable structure that functions independently of C-terminal regions .

  • Expression patterns: Unlike highly expressed IpaB/SipB proteins in Shigella and Salmonella, BipB expression is difficult to detect under laboratory conditions , suggesting unique regulatory mechanisms in Burkholderia.

This comparative analysis helps researchers leverage knowledge from well-studied systems to inform investigations of BipB, while acknowledging the unique aspects of Burkholderia T3SS biology.

What techniques are most effective for studying BipB-host cell interactions during infection?

Investigating BipB-host cell interactions requires sophisticated methodological approaches:

  • Heterologous expression systems:

    • Expression of BipB in well-characterized systems like Shigella can provide insights into its incorporation into T3SS structures and function

    • These systems allow visualization of protein localization using techniques like confocal immunofluorescence

  • Advanced microscopy:

    • Super-resolution microscopy to visualize BipB localization during infection

    • Live-cell imaging to track BipB dynamics in real-time

    • Correlative light and electron microscopy (CLEM) to link functional observations with ultrastructural details

  • Protein-protein interaction studies:

    • Co-immunoprecipitation to identify host and bacterial binding partners

    • Proximity labeling techniques (BioID, APEX) to map the interactome of BipB during infection

    • Yeast two-hybrid or bacterial two-hybrid screening for interaction partners

  • Functional assays:

    TechniqueApplicationExpected Outcome
    Cell invasion assaysCompare wild-type vs. BipB mutantsQuantification of invasion defects
    Pore formation assaysMeasure membrane permeabilizationAssessment of translocator function
    Effector translocation assaysTrack movement of reporter-tagged effectorsEvaluation of BipB's role in effector delivery
  • Host response analysis:

    • Transcriptomics/proteomics to identify host pathways affected by BipB

    • Immunological assays to characterize innate immune recognition of BipB

These approaches can provide comprehensive insights into BipB's role during the infection process.

What are the best strategies for generating and validating BipB mutants in B. pseudomallei?

Creating and validating BipB mutants in B. pseudomallei requires careful consideration of biosafety and methodological approaches:

  • Mutagenesis strategies:

    • Allelic exchange using suicide vectors with antibiotic resistance markers

    • CRISPR-Cas9 genome editing for scarless mutations

    • Inducible expression systems to create conditional mutants

  • Biosafety considerations:

    • Work must be conducted in appropriate biosafety level facilities (BSL-3)

    • Consider using attenuated strains or the closely related B. thailandensis for initial studies

  • Validation approach:

    Validation MethodPurposeExpected Results
    PCR verificationConfirm genetic modificationAltered amplicon size or sequence
    RT-qPCRVerify transcriptional impactAbsence/reduction of BipB transcript
    Western blotConfirm protein expression changesAbsence of BipB protein or altered size
    ComplementationRestore wild-type phenotypeRecovery of function with BipB expression
    Phenotypic assaysAssess functional consequencesAltered invasion, intracellular survival
  • Controls:

    • Include wild-type parental strain

    • Create complemented mutant strains

    • Consider creating mutations in homologous genes in related Burkholderia species

This systematic approach ensures the generation of reliable mutants for studying BipB function while maintaining appropriate biosafety standards.

How can researchers establish reliable assays to measure BipB-mediated translocation of effector proteins?

Developing assays to measure BipB-mediated translocation requires sophisticated experimental design:

  • Reporter-based systems:

    • Fusion of effector proteins with enzymes like β-lactamase or adenylate cyclase

    • Fluorescent reporters such as split-GFP where one part is fused to the effector

    • These allow quantitative measurement of translocation events

  • Biochemical fractionation:

    • Careful separation of cytoplasmic and membrane fractions from infected cells

    • Western blot analysis to detect effector proteins in host cell compartments

    • Comparison between wild-type and BipB mutant strains

  • Microscopy approaches:

    • Immunofluorescence microscopy using antibodies against effector proteins

    • Time-lapse imaging to capture translocation kinetics

    • Quantitative image analysis to measure effector localization

  • Assay standardization:

    ParameterStandardization ApproachImportance
    MOI (multiplicity of infection)Titration experimentsEnsures consistent infection rates
    Time pointsMultiple sampling intervalsCaptures dynamics of translocation
    Cell typesTesting multiple relevant cell linesAccounts for cell-type specific differences
    ControlsIncluding T3SS-defective strainsEstablishes baseline and specificity
  • Data analysis:

    • Normalization to account for differences in bacterial adherence

    • Statistical analysis to assess significance of observed differences

    • Dose-response relationships to understand translocation efficiency

These methodological approaches provide researchers with reliable tools to investigate the specific role of BipB in effector translocation.

What structural biology techniques are most appropriate for studying BipB structure-function relationships?

Understanding BipB structure-function relationships requires a multi-technique approach:

This integrated approach can reveal crucial insights into how BipB's structure enables its role in pathogenesis.

What are the main challenges in developing BipB-targeted therapeutics and diagnostics?

Developing BipB-targeted interventions faces several significant challenges:

  • Therapeutic targeting limitations:

    • Low expression levels of BipB under standard conditions

    • Limited surface accessibility of BipB during infection

    • Potential functional redundancy with other bacterial proteins

    • Need for therapeutics that can reach intracellular bacteria

  • Diagnostic challenges:

    • Cross-reactivity with related bacterial species

    • Previous exposure to B. pseudomallei in endemic regions confounding serological tests

    • Low diagnostic accuracy observed in ELISA-based detection

    • Requirement for high sensitivity to detect low abundance protein

  • Technical obstacles:

    ChallengeImpactPotential Solutions
    Protein conservationCross-reactivity with other bacteriaFocus on unique epitopes identified through epitope mapping
    Conditional expressionInconsistent detectionIdentify reliable biomarkers that correlate with BipB expression
    Background seroprevalenceFalse positives in endemic areasDevelop assays that distinguish acute from historical exposure
    Biosafety requirementsLimited research accessibilityDevelop safe surrogates using related proteins from BSL-2 organisms
  • Future research priorities:

    • Improved understanding of BipB expression regulation

    • Identification of unique epitopes for specific targeting

    • Development of conditional expression systems for functional studies

    • Investigation of combination approaches for diagnostics and therapeutics

Addressing these challenges requires innovative approaches and collaborative research efforts spanning structural biology, immunology, and clinical research.

How might BipB be incorporated into multi-component vaccine strategies against B. pseudomallei?

While BipB alone does not provide significant protection as a vaccine antigen , its integration into multi-component strategies shows promise:

  • Combination approaches:

    • Inclusion of BipB alongside other T3SS components (BipC, BipD)

    • Combination with protective antigens from other virulence systems

    • Use of BipB as part of whole-cell killed or live attenuated vaccines

  • Delivery platform considerations:

    • Recombinant protein subunit vaccines with appropriate adjuvants

    • DNA vaccines encoding BipB and other antigens

    • Viral vector vaccines for enhanced cellular immunity

    • Outer membrane vesicle (OMV) presentation of multiple antigens

  • Immunological optimization:

    StrategyRationaleExpected Outcome
    Epitope selectionFocus on protective epitopesEnhanced protective efficacy
    Adjuvant selectionTailored immune responseBalanced humoral and cellular immunity
    Prime-boost regimensMaximize immune memoryDurable protection
    Formulation optimizationStability and deliveryPractical field application
  • Rational design approach:

    • Structure-based antigen engineering to expose critical epitopes

    • Creation of chimeric proteins incorporating protective domains

    • Cross-protective design targeting conserved regions across Burkholderia species

  • Evaluation metrics:

    • Balanced humoral and cellular immune responses

    • Protection against multiple routes of infection

    • Long-term protective immunity

    • Cross-protection against diverse B. pseudomallei strains

This integrated approach acknowledges BipB's limitations as a standalone vaccine while leveraging its potential contributions to a comprehensive vaccine strategy.

What are the most promising future research directions for BipB in B. pseudomallei pathogenesis?

Future research on BipB should focus on several key areas:

  • Regulatory mechanisms: Elucidating the environmental and molecular signals that control BipB expression and deployment during infection.

  • Structural biology: Determining high-resolution structures of BipB, particularly in complex with other T3SS components and host cell membranes.

  • Host-pathogen interactions: Identifying specific host cell targets and receptors that interact with BipB during the infection process.

  • Comparative biology: Expanding understanding of functional differences between BipB and its homologs in other bacterial pathogens to identify unique features.

  • Translational applications: Developing novel diagnostic approaches and therapeutic strategies targeting BipB and its interactions.

By addressing these research priorities, scientists can advance our understanding of B. pseudomallei pathogenesis and develop improved approaches to combat melioidosis, an important emerging infectious disease.

How does understanding BipB contribute to the broader field of bacterial pathogenesis?

BipB research contributes to bacterial pathogenesis understanding in several significant ways:

  • T3SS evolution: Insights into the conservation and divergence of T3SS components across bacterial species illuminate evolutionary paths of these sophisticated virulence mechanisms.

  • Host-pathogen interface: BipB sits at the critical juncture between pathogen and host, providing a model for studying membrane interactions and protein translocation.

  • Virulence regulation: The complex regulation of BipB expression exemplifies how pathogens coordinate virulence factor deployment in response to environmental cues.

  • Immune evasion strategies: Understanding how B. pseudomallei uses BipB and other T3SS components to evade host defenses reveals broader principles of bacterial persistence.

  • Therapeutic targeting concepts: Lessons from BipB research inform approaches to targeting virulence mechanisms rather than bacterial viability, potentially addressing antimicrobial resistance concerns.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.