Recombinant Burkholderia pseudomallei UPF0060 membrane protein BPSL1340 (BPSL1340)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
BPSL1340; UPF0060 membrane protein BPSL1340
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-110
Protein Length
full length protein
Species
Burkholderia pseudomallei (strain K96243)
Target Names
BPSL1340
Target Protein Sequence
MLSLAKIAALFVLTAVAEIVGCYLPWLVLKAGKPAWLLAPAALSLALFAWLLTLHPAAAA RTYAAYGGVYIAVALAWLRIVDGVPLSRWDVAGAALALAGMSVIALQPRG
Uniprot No.

Target Background

Database Links

KEGG: bps:BPSL1340

Protein Families
UPF0060 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Burkholderia pseudomallei UPF0060 membrane protein BPSL1340?

BPSL1340 is a membrane protein from Burkholderia pseudomallei, the causative agent of melioidosis. It belongs to the UPF0060 protein family and consists of 110 amino acids. The protein is expressed in the bacterial membrane and has potential immunogenic properties. For research purposes, it is commonly produced as a recombinant protein with an N-terminal His-tag expressed in E. coli expression systems .

What are the optimal storage and handling conditions for recombinant BPSL1340?

Based on experimental data, the following conditions are recommended for optimal storage and handling of recombinant BPSL1340:

ParameterRecommended Condition
Storage temperature-20°C/-80°C upon receipt
Buffer compositionTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionDeionized sterile water to 0.1-1.0 mg/mL
Long-term storageAdd 5-50% glycerol (50% recommended) and aliquot
Usage recommendationAvoid repeated freeze-thaw cycles
Working aliquotsStore at 4°C for up to one week

The protein is typically supplied as a lyophilized powder and should be briefly centrifuged prior to opening to bring contents to the bottom of the vial .

How can factorial design optimize the expression of soluble BPSL1340?

Factorial design is a powerful approach for optimizing recombinant protein expression. For BPSL1340, researchers should consider the following variables in a multivariate experimental design:

  • Induction timing (cell density at induction)

  • Inducer concentration (typically IPTG)

  • Post-induction temperature

  • Post-induction duration

  • Media composition

  • Antibiotic concentration

  • Glucose concentration

  • Expression strain selection

Based on similar membrane protein expression studies, a 2^8-4 factorial design can be employed to evaluate these variables with minimal experimental runs. Statistical analysis of the results would identify the most significant factors affecting soluble protein yield .

For example, an optimized condition might include:

  • Growth until OD600 of 0.8

  • Induction with 0.1 mM IPTG

  • Expression at 25°C for 4 hours

  • Media containing 5 g/L yeast extract, 5 g/L tryptone, 10 g/L NaCl, and 1 g/L glucose

  • Appropriate antibiotic selection (e.g., 30 μg/mL kanamycin)

What analytical methods are most appropriate for assessing BPSL1340 purity and functionality?

Multiple complementary analytical methods should be employed:

MethodPurposeExpected Result
SDS-PAGEPurity assessmentSingle band at ~12 kDa (plus tag)
Western blotIdentity confirmationSpecific binding with anti-His antibody
Size exclusion chromatographyOligomeric state analysisPrimarily monomeric in detergent
Circular dichroismSecondary structure analysisPredominantly α-helical content
Membrane insertion assayFunctional analysisInsertion into artificial lipid bilayers
Antibody recognition testImmunogenicity assessmentRecognition by melioidosis patient sera

Functionality assays specific to membrane proteins may require reconstitution into proteoliposomes or nanodiscs for proper evaluation of native conformation .

What is the recommended experimental design for evaluating BPSL1340 immunogenicity?

For rigorous evaluation of BPSL1340 immunogenicity, researchers should follow this methodological approach:

  • Protein preparation:

    • Express and purify recombinant BPSL1340 with >90% purity

    • Ensure proper folding through functional assays

    • Prepare in appropriate buffer for immunization

  • Animal model setup:

    • Use BALB/c mice (8-10 per group)

    • Include proper controls (unimmunized, adjuvant-only, known immunogenic protein)

  • Immunization protocol:

    • Primary immunization followed by 2-3 boosters at 2-week intervals

    • Evaluate different adjuvant formulations

    • Test multiple immunization routes (subcutaneous, intraperitoneal)

  • Immunological assessment:

    • Measure antibody titers by ELISA

    • Analyze antibody isotypes (IgG1, IgG2a, etc.)

    • Evaluate T cell responses (cytokine production, proliferation)

    • Perform Western blot analysis with patient sera

  • Challenge study:

    • Challenge with 1×10^6 CFU B. pseudomallei intraperitoneally

    • Monitor survival for at least 21 days

    • Analyze bacterial burden in tissues

    • Evaluate histopathological changes

This comprehensive approach allows for direct comparison with established vaccine candidates like Omp3 and Omp7 .

How can BPSL1340 structure-function relationships be effectively investigated?

A multi-faceted approach to structure-function analysis should include:

  • Bioinformatic analysis:

    • Sequence alignment with related proteins

    • Structural prediction using AlphaFold or similar tools

    • Identification of conserved domains and motifs

  • Site-directed mutagenesis:

    • Target conserved residues

    • Create truncation variants

    • Modify predicted functional regions

  • Structural studies:

    • X-ray crystallography (may require removal of highly hydrophobic regions)

    • Cryo-electron microscopy

    • NMR for specific domains

  • Functional assays:

    • Membrane insertion assays

    • Protein-protein interaction studies

    • Lipid binding analysis

  • Cell-based studies:

    • Localization in bacterial cells

    • Impact of overexpression on bacterial physiology

    • Host cell interaction studies

Each mutant should be systematically evaluated for membrane localization, stability, and immunoreactivity to establish structure-function relationships .

What are common challenges in expressing soluble BPSL1340 and how can they be addressed?

As a membrane protein, BPSL1340 presents several expression challenges:

ChallengePotential SolutionsExperimental Approach
Inclusion body formationLower induction temperature (16-25°C)Test 16°C, 20°C, and 25°C with extended expression times
Reduce inducer concentrationTest IPTG gradient (0.01-1.0 mM)
Use specialized expression strainsCompare C41(DE3), C43(DE3), and Rosetta-gami strains
Protein misfoldingInclude molecular chaperonesCo-express with GroEL/GroES or DnaK/DnaJ/GrpE
Add membrane-mimicking agentsInclude detergents like DDM or LDAO in lysis buffer
Low expression levelsOptimize codon usageGenerate codon-optimized synthetic gene
Try alternative promotersCompare T7, tac, and arabinose-inducible systems
Protein toxicityUse tight expression controlTest glucose repression and/or lacI overexpression
Employ auto-induction mediaCompare with standard IPTG induction

Systematic testing of these variables using design of experiment (DoE) approaches can efficiently identify optimal conditions .

How can protein folding and membrane integration be assessed for recombinant BPSL1340?

Proper folding is critical for membrane protein functionality and can be assessed through:

  • Detergent screening:

    • Test protein stability in various detergents (DDM, OG, LDAO)

    • Monitor by size-exclusion chromatography

    • Assess monodispersity by dynamic light scattering

  • Limited proteolysis:

    • Compare digestion patterns of purified protein versus denatured controls

    • Well-folded proteins typically show resistance to proteolysis

  • Intrinsic fluorescence:

    • Monitor tryptophan fluorescence to assess tertiary structure

    • Compare with denatured protein spectra

  • Membrane insertion assays:

    • Reconstitution into proteoliposomes

    • Sucrose gradient flotation assays

    • Membrane protein extraction analysis

  • Thermal stability assays:

    • Differential scanning fluorimetry with membrane-protein compatible dyes

    • Monitor unfolding transitions as measure of stability

These approaches provide complementary data on protein folding quality and can guide optimization of expression and purification protocols .

What methods can be used to analyze interactions between BPSL1340 and host immune components?

To characterize interactions between BPSL1340 and host immune components, researchers should consider:

  • Serum antibody binding analysis:

    • ELISA with patient sera from melioidosis cases

    • Western blot analysis under native and denaturing conditions

    • Epitope mapping using peptide arrays

  • T cell response assessment:

    • ELISPOT assays for IFN-γ production

    • T cell proliferation assays

    • Cytokine profiling (Th1/Th2/Th17)

  • Complement activation studies:

    • C3b/C4b deposition assays

    • Classical and alternative pathway analysis

    • Membrane attack complex formation

  • Pattern recognition receptor binding:

    • TLR interaction studies (particularly TLR2 and TLR4)

    • Pull-down assays with receptor ectodomains

    • Reporter cell assays for receptor activation

  • Antigen presentation analysis:

    • Dendritic cell activation and maturation

    • MHC Class II binding predictions and verification

    • Processing by antigen-presenting cells

These methods would provide comprehensive data on how BPSL1340 interacts with various components of innate and adaptive immunity, informing its potential as a vaccine candidate .

How can researchers effectively compare BPSL1340 with other B. pseudomallei membrane proteins?

A systematic comparative analysis should include:

  • Sequence and structural analysis:

    • Multiple sequence alignment

    • Phylogenetic relationship determination

    • 3D structural comparison

  • Expression profile analysis:

    • Transcriptomics under various conditions

    • Proteomics to confirm in vivo expression

    • Expression timing during infection

  • Comparative immunogenicity:

    • Side-by-side immunization studies

    • Cross-reactivity assessment

    • Epitope conservation analysis

  • Functional comparison:

    • Membrane localization patterns

    • Contribution to bacterial fitness

    • Role in host-pathogen interactions

  • Vaccination potential assessment:

    • Protection efficacy in animal models

    • Antibody and T cell response quality

    • Memory response durability

This multi-parameter comparison would place BPSL1340 in context with other membrane proteins like the OmpA family (Omp3 and Omp7) that have shown promise as vaccine candidates .

What novel approaches could enhance BPSL1340 expression and functionality for research applications?

Several innovative approaches could improve BPSL1340 research:

  • Alternative expression systems:

    • Cell-free protein synthesis in presence of nanodiscs or liposomes

    • Bacillus subtilis expression for improved folding of membrane proteins

    • Insect cell or mammalian cell expression for complex membrane proteins

  • Protein engineering approaches:

    • Fusion with fluorescent proteins for tracking and localization studies

    • Addition of solubility-enhancing tags (SUMO, MBP)

    • Surface entropy reduction for crystallization

  • Advanced purification strategies:

    • Styrene maleic acid lipid particles (SMALPs) for native membrane extraction

    • Affinity purification with engineered nanobodies

    • Lipid nanodiscs for stable membrane protein reconstitution

  • Structural biology innovations:

    • Microcrystal electron diffraction (MicroED)

    • Single-particle cryo-EM for membrane proteins

    • Solid-state NMR approaches

  • High-throughput screening platforms:

    • Automated expression condition optimization

    • Detergent/lipid matrix screening

    • Stability assessment via differential scanning fluorimetry

These approaches could significantly improve the yield, purity, and functional characteristics of recombinant BPSL1340, facilitating more advanced structural and immunological studies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.