Recombinant Burkholderia pseudomallei UPF0060 membrane protein BURPS1106A_1494 (BURPS1106A_1494)

Shipped with Ice Packs
In Stock

Description

Overview of Burkholderia pseudomallei UPF0060 Membrane Protein BURPS1106A_1494

The Burkholderia pseudomallei UPF0060 membrane protein BURPS1106A_1494 is a protein found in the bacterium Burkholderia pseudomallei, the causative agent of melioidosis . Melioidosis is a disease with high morbidity and mortality in humans and animals, particularly in endemic regions .

  • Burkholderia pseudomallei possesses two circular chromosomes which contain numerous genes encoding virulence factors that promote infection in various hosts and survival within cells .

  • The protein is a part of the UPF0060 family, which stands for "Unknown Protein Function," indicating that its precise function is not yet fully understood . These proteins are identified through bioinformatics analysis but lack functional characterization .

Immunogenic Properties

Burkholderia pseudomallei outer membrane proteins (OmpA) have demonstrated immunogenic properties, suggesting their potential as vaccine candidates .

  • OmpA proteins are often involved in bacterial virulence and immunity .

  • Studies have shown that B. pseudomallei OmpA proteins are immunogenic in mice and melioidosis patients .

  • Immunization with Omp3 or Omp7 (two types of OmpA) has shown some protection in mice against B. pseudomallei infection .

Role in Virulence and Pathogenesis

The bacterium employs various virulence factors to promote successful infection of hosts:

  • Adhesins and surface attachment factors .

  • Type III secretion system cluster 3 (T3SS3) .

  • Factors that modulate host cell tubulin and evade host cell autophagy .

  • Type VI secretion system cluster 5 (T6SS-5) .

Association with SapR Regulation

The SapR regulator influences membrane-associated virulence factors, peptidoglycan, lipid, and nitrogen metabolism . SapR regulates various genes including:

  • Outer membrane porins

  • The autotransporter BatA, which is protective in vaccination against lethal aerosol infection .

  • Outer membrane channel forming protein TolC, which is tied to bacterial virulence and pathogenesis .

Potential Applications and Further Research

Given its role in bacterial structure and potential involvement in virulence, BURPS1106A_1494 is a candidate for further research:

  • Further assessment as potential vaccine candidates against B. pseudomallei infection .

  • Understanding the basic biology and genomics of B. pseudomallei is imperative for the development of new vaccines and therapeutic interventions .

  • Functional analyses of metabolic networks, virulence, and regulation shows promise for examining the effects of B. pseudomallei .

Recombinant BURPS668_1464 Protein Information

Recombinant Full Length Burkholderia pseudomallei UPF0060 membrane protein BURPS668_1464 (BURPS668_1464) Protein, His-Tagged is expressed in E. coli .

SpecificationDetails
SpeciesBurkholderia pseudomallei
SourceE.coli
TagHis
Protein LengthFull Length (1-110aa)
FormLyophilized powder

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement. We will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
BURPS1106A_1494; UPF0060 membrane protein BURPS1106A_1494
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-110
Protein Length
full length protein
Species
Burkholderia pseudomallei (strain 1106a)
Target Names
BURPS1106A_1494
Target Protein Sequence
MLSLAKIAALFVLTAVAEIVGCYLPWLVLKAGKPAWLLAPAALSLALFAWLLTLHPAAAA RTYAAYGGVYIAVALAWLRIVDGVPLSRWDVAGAALALAGMSVIALQPRG
Uniprot No.

Target Background

Database Links
Protein Families
UPF0060 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is BURPS1106A_1494 and what is its significance in pathogenicity research?

    BURPS1106A_1494 is a UPF0060 family membrane protein found in Burkholderia pseudomallei strain 1106a, the causative agent of melioidosis - a disease with high morbidity and mortality in humans and animals, particularly in endemic regions of Southeast Asia and Northern Australia. The "UPF0060" designation indicates that its precise function remains not fully understood, as it has been identified through bioinformatics analysis but lacks functional characterization.

    Significance: B. pseudomallei possesses two circular chromosomes containing numerous genes encoding virulence factors that promote infection in various hosts and survival within cells. Membrane proteins like BURPS1106A_1494 often play critical roles in bacterial pathogenicity, making them important targets for understanding disease mechanisms and developing therapeutic interventions.

  • How can researchers effectively express and purify recombinant BURPS1106A_1494?

    For effective expression and purification of recombinant BURPS1106A_1494, researchers should consider the following methodological approach:

    1. Expression system selection: E. coli has been used successfully as an expression host for recombinant BURPS1106A_1494 with His-tag modifications .

    2. Optimization strategies: Membrane proteins present particular challenges for expression. Consider approaches similar to those used for other membrane proteins:

      • Use of specialized vectors designed for membrane protein expression

      • Temperature optimization during induction (often lower temperatures of 16-25°C)

      • Controlled induction using varying IPTG concentrations

    3. Purification protocol:

      • Lysis in buffer containing appropriate detergents to solubilize membrane proteins

      • Affinity chromatography using His-tag or other fusion tags

      • Size exclusion chromatography for final purification

    4. Storage recommendations: Store at -20°C in Tris-based buffer with 50% glycerol. Avoid repeated freeze-thaw cycles and maintain working aliquots at 4°C for up to one week .

  • What is known about the UPF0060 protein family across bacterial species?

    The UPF0060 family comprises membrane proteins found across various bacterial species with largely uncharacterized functions. Research on this family reveals:

    • The designation "UPF" stands for "Unknown Protein Function," indicating proteins identified through computational analysis but lacking experimental functional characterization.

    • Similar UPF0060 proteins have been identified in different strains of B. pseudomallei, including strain K96243 (BPSL1340) and strain 668 (BURPS668_1464) , suggesting conservation within the species.

    • While specific functions remain unclear, proteins in this family typically share structural similarities and membrane localization.

    • UPF0060 proteins may be involved in membrane integrity, transport, or signaling functions based on their localization, though experimental verification is needed.

    • Methodological approach to characterizing novel UPF family proteins typically involves comparative genomics, structural prediction, and directed mutagenesis to assess functional roles.

Advanced Research Questions

  • What experimental approaches are most effective for determining the function of BURPS1106A_1494?

    Determining the function of BURPS1106A_1494 requires a multi-faceted experimental approach:

    1. Genetic manipulation techniques:

      • Gene knockout studies using site-specific recombination systems approved for Burkholderia spp. to observe phenotypic changes

      • Complementation studies to verify observed phenotypes

      • Conditional expression systems to study essential genes

    2. Protein interaction studies:

      • Pull-down assays with tagged BURPS1106A_1494

      • Bacterial two-hybrid systems

      • Cross-linking followed by mass spectrometry

    3. Structural biology approaches:

      • NMR spectroscopy using paramagnetic probes, similar to methods used for other membrane proteins

      • Cryo-electron microscopy for membrane protein complexes

    4. Functional assays:

      • Membrane integrity assessments

      • Transport assays if a transporter function is suspected

      • Growth under various stress conditions comparing wild-type and mutant strains

    5. Comparative genomics:

      • Analysis of conservation and co-evolution with other genes

      • Prediction of functional partners through gene neighborhood analysis

  • How can BURPS1106A_1494 be utilized in developing diagnostic tools for melioidosis?

    Development of diagnostic tools using BURPS1106A_1494 would follow these methodological steps:

    1. Immunogenicity assessment:

      • Evaluate if BURPS1106A_1494 elicits antibody responses in melioidosis patients

      • Compare antibody titers between patients, asymptomatic carriers, and negative controls

    2. Development of serological assays:

      • ELISA development using purified recombinant BURPS1106A_1494, similar to approaches used with other B. pseudomallei recombinant proteins

      • Western blot analysis to assess sensitivity and specificity

      • Optimization of assay conditions for clinical use

    3. Validation studies:

      • Testing against serum panels from:

        • Confirmed melioidosis cases

        • Endemic healthy controls

        • Non-endemic healthy controls

        • Patients with similar clinical presentations

    4. Combination approaches:

      • Assess if BURPS1106A_1494 can be combined with other antigens for improved diagnostic performance

      • Develop multiplex assays incorporating multiple biomarkers

    Research has shown that B. pseudomallei-specific recombinant proteins can achieve high specificity (98.5-100%) in distinguishing melioidosis patients from healthy controls in both endemic and non-endemic areas . A similar approach could be applied to evaluate BURPS1106A_1494's diagnostic potential.

  • What strategies can be employed to study membrane interactions and topology of BURPS1106A_1494?

    To study membrane interactions and topology of BURPS1106A_1494, researchers should consider these methodological approaches:

    1. Computational prediction methods:

      • Hydropathy analysis to identify transmembrane domains

      • Topology prediction algorithms to determine orientation in the membrane

    2. Experimental topology mapping:

      • Cysteine scanning mutagenesis with accessibility assays

      • Fusion protein approaches with reporter enzymes (e.g., PhoA, LacZ)

      • Protease protection assays

    3. Lipid interaction studies:

      • Reconstitution in lipid bilayers of varying composition

      • Fluorescence spectroscopy to measure protein-lipid interactions

      • Differential scanning calorimetry to assess thermal stability in different lipid environments

    4. Advanced structural techniques:

      • Site-directed spin labeling coupled with electron paramagnetic resonance (EPR)

      • Hydrogen-deuterium exchange mass spectrometry

      • Solid-state NMR using approaches similar to those applied for other membrane proteins

    5. Functional reconstitution:

      • Incorporation into liposomes or nanodiscs

      • Assessment of functional activity in defined membrane environments

  • What is the potential role of BURPS1106A_1494 in vaccine development for melioidosis?

    Exploring BURPS1106A_1494 as a vaccine candidate would involve:

    1. Antigenicity and immunogenicity assessment:

      • Evaluation of B-cell and T-cell epitopes within BURPS1106A_1494

      • Animal immunization studies to assess antibody production and cellular immune responses

    2. Protective efficacy studies:

      • Challenge studies in appropriate animal models

      • Comparison with known protective antigens

    Research on other B. pseudomallei outer membrane proteins (OmpA) has shown immunogenic properties and protection in mouse models. Similar approaches could be applied to BURPS1106A_1494:

    ApproachMethodologyAssessment Criteria
    Active immunizationPurified recombinant protein with adjuvantsAntibody titers, survival rates after challenge
    Passive immunizationTransfer of antibodies against BURPS1106A_1494Protection against lethal challenge
    DNA vaccinePlasmid encoding BURPS1106A_1494Cell-mediated and humoral immune responses
    Multi-antigen approachCombination with other protective antigensSynergistic protection

    Studies of OmpA proteins have shown that immunization with certain membrane proteins (Omp3 or Omp7) provided some protection in mice against B. pseudomallei infection, suggesting a similar approach could be valuable for BURPS1106A_1494.

  • How does genetic diversity of BURPS1106A_1494 across different B. pseudomallei strains affect research applications?

    Analysis of genetic diversity requires:

    1. Comparative genomic analysis:

      • Sequence alignment of BURPS1106A_1494 homologs across multiple B. pseudomallei isolates

      • Identification of conserved and variable regions

    2. Evolutionary analysis:

      • Assessment of selective pressures using dN/dS ratios

      • Phylogenetic analysis of sequence variants

    3. Functional implications:

      • Mapping of variants to predicted functional domains

      • Expression of variant proteins to assess functional differences

    4. Epidemiological correlations:

      • Association of specific variants with:

        • Geographical distribution

        • Clinical outcomes

        • Antimicrobial resistance profiles

    5. Research and diagnostic implications:

      • Selection of conserved epitopes for diagnostic development

      • Identification of strain-specific variations that might affect vaccine efficacy

    Similar proteins have been identified in different B. pseudomallei strains including K96243 (BPSL1340) and strain 668 (BURPS668_1464) , suggesting conservation of this protein family within the species, which is important for developing broadly effective diagnostics or vaccines.

  • What methodological approaches can overcome challenges in functional characterization of BURPS1106A_1494?

    Functional characterization of this membrane protein presents several challenges requiring specialized approaches:

    1. Heterologous expression optimization:

      • Use of specialized expression systems like Mistic fusion technology, which enables autonomous membrane integration

      • Testing multiple expression hosts including E. coli, B. subtilis, and eukaryotic systems

      • Codon optimization for improved expression

    2. Genetic manipulation strategies:

      • Implementation of approved antimicrobial selection markers for Burkholderia

      • Application of non-antibiotic selection systems like tellurite resistance (kilA-telAB) or triclosan resistance (FabL)

      • CRISPR-Cas9 based genome editing for precise modifications

    3. Functional screening approaches:

      • Phenotypic microarrays to identify conditions where the protein becomes essential

      • Suppressor mutation analysis to identify functional pathways

      • Chemical genetic approaches using small molecule libraries

    4. Conditional expression systems:

      • Inducible promoters for temporal control of expression

      • Degron-based systems for controlled protein degradation

    5. Participatory research approaches:

      • Collaborative efforts combining multiple methodologies across different research groups

      • Integration of bioinformatic predictions with experimental validation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.