Recombinant Burkholderia pseudomallei UPF0060 membrane protein BURPS668_1464 (BURPS668_1464)

What is the basic structure and composition of Recombinant Burkholderia pseudomallei UPF0060 membrane protein BURPS668_1464?

Recombinant Burkholderia pseudomallei UPF0060 membrane protein BURPS668_1464 is a full-length protein (amino acids 1-110) derived from Burkholderia pseudomallei but typically expressed in E. coli expression systems for research purposes. The protein features an N-terminal His tag to facilitate purification and detection in experimental settings. The complete amino acid sequence is: MLSLAKIAALFVLTAVAEIVGCYLPWLVLKAGKPAWLLAPAALSLALFAWLLTLHPAAAARTYAAYGGVYIAVALAWLRIVDGVPLSRWDVAGAALALAGMSVIALQPRG . This sequence analysis reveals a predominantly hydrophobic profile consistent with its membrane protein classification, suggesting multiple transmembrane domains that anchor the protein within the bacterial membrane.

How is the purity of Recombinant BURPS668_1464 protein typically assessed in research settings?

The purity assessment of Recombinant BURPS668_1464 protein is primarily conducted using SDS-PAGE (Sodium Dodecyl Sulfate-Polyacrylamide Gel Electrophoresis) analysis. Commercial preparations typically achieve greater than 90% purity as determined by this method . For more rigorous research applications, researchers should consider implementing additional analytical techniques such as:

Researchers should document both the purity percentage and the specific analytical methods used when reporting experimental results to ensure reproducibility across different laboratories.

What are the recommended storage and handling conditions for maintaining BURPS668_1464 protein stability?

Optimal storage of BURPS668_1464 protein requires careful attention to temperature conditions and buffer composition. The lyophilized protein should be stored at -20°C or preferably -80°C upon receipt . After reconstitution, working aliquots may be stored at 4°C for up to one week, but repeated freeze-thaw cycles should be strictly avoided as they can lead to protein denaturation and activity loss . For long-term storage after reconstitution, the addition of glycerol to a final concentration of 50% is recommended before storing at -20°C/-80°C . Proper storage buffer formulation typically consists of a Tris/PBS-based buffer with 6% trehalose at pH 8.0, which helps maintain protein stability and prevent aggregation . For experimental workflows requiring extended protein use, researchers should create multiple small-volume aliquots during initial reconstitution rather than repeatedly accessing a single stock solution.

What protocols are recommended for optimal reconstitution of lyophilized BURPS668_1464 protein?

The reconstitution process for lyophilized BURPS668_1464 protein requires meticulous attention to detail to maintain protein integrity and bioactivity. Begin by briefly centrifuging the vial containing the lyophilized protein to ensure all material is collected at the bottom before opening . Reconstitute the protein in deionized sterile water to achieve a concentration between 0.1-1.0 mg/mL . The addition of glycerol to a final concentration of 50% is strongly recommended for stability enhancement, though researchers may adjust this between 5-50% depending on downstream applications . Gentle inversion or slow rotation rather than vigorous shaking or vortexing should be employed to dissolve the protein completely while minimizing protein denaturation or aggregation. After reconstitution, researchers should document the precise reconstitution conditions, including buffer composition, protein concentration, and glycerol percentage, as these parameters can significantly influence experimental outcomes in functional assays or structural studies.

How should researchers design experiments to investigate membrane localization of BURPS668_1464 protein?

Investigating the membrane localization of BURPS668_1464 requires a multi-faceted experimental approach. Based on its classification as a UPF0060 membrane protein with hydrophobic domains, researchers should implement the following methodological strategy:

• Subcellular Fractionation: Separate bacterial cellular components (cytoplasm, inner membrane, periplasm, and outer membrane) using differential centrifugation and detergent-based extraction methods. Detect BURPS668_1464 distribution using Western blotting with anti-His antibodies.

• Immunofluorescence Microscopy: Utilize fluorescently labeled antibodies against the His-tag to visualize protein localization within fixed bacterial cells, comparing patterns with known membrane protein markers.

• Protease Accessibility Assays: Treat intact bacteria with proteases that cannot penetrate the cell membrane, then analyze which protein regions remain protected versus degraded to determine topology.

• GFP Fusion Analysis: Generate fusion constructs with GFP at either N- or C-terminus to track membrane protein localization in living cells using fluorescence microscopy.

What strategies are recommended for investigating protein-protein interactions involving BURPS668_1464?

Investigating protein-protein interactions of BURPS668_1464 requires specialized approaches due to its membrane protein nature. A comprehensive experimental strategy should employ multiple complementary techniques:

When analyzing results, researchers should prioritize interactions detected by multiple independent methods and validate findings using targeted mutagenesis of key residues to disrupt specific interactions. The experimental design should also consider detergent selection carefully, as inappropriate detergents can disrupt native protein-protein interactions of membrane proteins.

How can researchers effectively analyze the role of BURPS668_1464 in bacterial pathogenesis?

Analyzing the role of BURPS668_1464 in Burkholderia pseudomallei pathogenesis requires a comprehensive experimental approach that integrates molecular, cellular, and in vivo methodologies. Researchers should implement the following systematic strategy:

• Gene Knockout/Knockdown Studies: Generate BURPS668_1464 deletion mutants or employ CRISPR-Cas9 gene editing to create precise mutations. Compare growth kinetics, morphology, and stress responses between mutant and wild-type strains using standardized microbiological assays.

• Infection Models: Evaluate the virulence of BURPS668_1464 mutants in established infection models, including:

  • Cell culture models (macrophage invasion and intracellular survival)

  • Caenorhabditis elegans (for preliminary pathogenesis assessment)

  • Murine models (for systemic infection studies)

  Quantify bacterial burden, host immune responses, and survival rates.

• Complementation Studies: Reintroduce functional BURPS668_1464 in mutant strains to confirm phenotype restoration, thereby establishing causality rather than correlation.

• Transcriptomic/Proteomic Analysis: Compare gene/protein expression profiles between wild-type and mutant strains under infection-relevant conditions to identify downstream pathways affected by BURPS668_1464 disruption.

• Structural Biology Approaches: Utilize X-ray crystallography or cryo-EM to determine the three-dimensional structure of BURPS668_1464, potentially revealing functional domains relevant to pathogenesis.

This multidisciplinary approach allows researchers to establish definitive relationships between BURPS668_1464 function and bacterial pathogenicity while minimizing experimental artifacts that could arise from any single experimental system.

What are common challenges in working with BURPS668_1464 protein and how can researchers overcome them?

Researchers working with BURPS668_1464 membrane protein frequently encounter several technical challenges that can be addressed through systematic troubleshooting approaches:

• Low Protein Solubility: As a membrane protein, BURPS668_1464 can exhibit poor solubility in aqueous buffers. To mitigate this issue:

  • Screen multiple detergents (DDM, LDAO, OG) at various concentrations

  • Consider using amphipols or nanodiscs for stabilization

  • Optimize buffer composition (pH 7.0-8.5, salt concentration 100-500 mM)

  • Add stabilizing agents such as glycerol (5-10%) or specific lipids

• Protein Aggregation: To minimize aggregation during purification and storage:

  • Maintain samples at 4°C during purification steps

  • Consider size exclusion chromatography as a final purification step

  • Centrifuge samples before experiments to remove pre-formed aggregates

  • Monitor aggregation using dynamic light scattering

• Activity Loss During Freeze-Thaw Cycles: To preserve functional integrity:

  • Divide protein into single-use aliquots immediately after purification

  • Use flash-freezing in liquid nitrogen rather than slow freezing

  • Add cryoprotectants such as glycerol, sucrose, or trehalose

  • Consider lyophilization for long-term storage

• Inconsistent Experimental Results: To improve reproducibility:

  • Standardize protein handling protocols across laboratory members

  • Document batch-to-batch variation through quality control testing

  • Use the same detergent and buffer conditions across comparative experiments

  • Implement positive controls to normalize experimental variations

Researchers should systematically document troubleshooting efforts and optimization parameters to build an evidence-based protocol specifically tailored to BURPS668_1464, as membrane protein behavior can vary significantly even among proteins from the same family.

How can researchers validate the structural integrity of purified BURPS668_1464 before functional studies?

Validating the structural integrity of purified BURPS668_1464 before proceeding with functional studies is critical for ensuring reliable and reproducible results. Researchers should implement a multi-technique validation approach:

• Circular Dichroism (CD) Spectroscopy: CD provides valuable information about secondary structure elements. For membrane proteins like BURPS668_1464, researchers should:

  • Collect spectra in the far-UV range (190-260 nm)

  • Compare observed spectra with theoretical predictions based on sequence

  • Monitor thermal stability by recording CD spectra at increasing temperatures

  • Document the alpha-helical content expected for transmembrane domains

• Intrinsic Fluorescence Spectroscopy: Tryptophan and tyrosine residues in BURPS668_1464 can serve as intrinsic fluorophores:

  • Excite at 280 nm and measure emission spectra (300-400 nm)

  • Changes in peak position or intensity can indicate conformational alterations

  • Compare spectra in native and denaturing conditions

• Size Exclusion Chromatography with Multi-Angle Light Scattering (SEC-MALS):

  • Assess protein homogeneity and oligomeric state

  • Detect presence of aggregates or degradation products

  • Determine accurate molecular weight in detergent micelles

• Limited Proteolysis:

  • Treat protein with proteases at low concentrations

  • Analyze digestion patterns using SDS-PAGE or mass spectrometry

  • Properly folded membrane proteins typically show resistance to proteolysis at transmembrane domains

• Negative Stain Electron Microscopy:

  • Visualize protein particles to assess homogeneity

  • Detect large-scale aggregation or structural abnormalities

  • Provide preliminary structural information

Researchers should establish standardized criteria for what constitutes "structurally intact" BURPS668_1464 based on these analyses and consistently apply these standards across all experimental batches to ensure data reproducibility and validity.

What statistical approaches are recommended for analyzing BURPS668_1464 functional data?

When analyzing functional data related to BURPS668_1464, researchers should implement robust statistical approaches tailored to specific experimental designs. The following framework is recommended:

• For Comparative Studies (wild-type vs. mutant):

  • Use unpaired t-tests for normally distributed data with equal variances

  • Apply Mann-Whitney U test for non-parametric data

  • Consider ANOVA with appropriate post-hoc tests (Tukey or Bonferroni) when comparing multiple groups

  • Report effect sizes (Cohen's d) in addition to p-values to quantify biological significance

• For Dose-Response Relationships:

  • Utilize non-linear regression to fit appropriate models (e.g., Hill equation)

  • Report EC50/IC50 values with 95% confidence intervals

  • Compare curves using extra sum-of-squares F test or AIC (Akaike Information Criterion)

• For Time-Course Experiments:

  • Apply repeated measures ANOVA or mixed-effects models

  • Consider area under the curve (AUC) analysis for comprehensive comparisons

  • Use appropriate corrections for multiple time point comparisons

• For High-Throughput Data (omics studies):

  • Control false discovery rate using Benjamini-Hochberg procedure

  • Implement dimension reduction techniques (PCA, t-SNE) for visualization

  • Consider pathway enrichment analysis to identify biological processes

Statistical power calculations should be performed a priori to determine appropriate sample sizes, and researchers should clearly report all statistical methods, including specific tests, p-value adjustments, and software packages used. Biological replicates (independent experiments) should be distinguished from technical replicates in both methodology and analysis.

How can researchers effectively compare their BURPS668_1464 findings with published literature on related UPF0060 family proteins?

Effective comparison of BURPS668_1464 research findings with published literature requires systematic analysis across multiple dimensions. Researchers should implement the following structured approach:

• Sequence-Based Comparison:

  • Perform comprehensive sequence alignments of BURPS668_1464 with other UPF0060 family proteins

  • Calculate sequence identity and similarity percentages

  • Identify conserved domains and motifs that may indicate shared functional regions

  • Generate phylogenetic trees to visualize evolutionary relationships

• Structural Comparison:

  • Align available structural data or predictive models

  • Compare topological features, particularly transmembrane domain organization

  • Identify conserved structural motifs that may indicate functional sites

  • Document structural differences that may explain functional divergence

• Functional Parameter Comparison:

  • Create standardized comparison tables of measured parameters:

• Methodological Context Analysis:

  • Critically evaluate methodological differences between studies

  • Assess whether divergent results arise from biological differences or technical variations

  • Replicate key published experiments using identical protocols where discrepancies exist

  • Document experimental conditions that may influence cross-study comparability

• Functional Context Integration:

  • Compare physiological roles across bacterial species

  • Evaluate conservation of interaction partners and regulatory mechanisms

  • Assess involvement in similar or divergent cellular pathways

  • Consider evolutionary context when interpreting functional differences

This structured comparative approach allows researchers to contextualize their findings within the broader UPF0060 protein family literature while accounting for methodological variations that might influence interpretation of apparent similarities or differences.

What are promising future research directions for BURPS668_1464 protein studies?

The study of BURPS668_1464 offers several promising research avenues that could significantly advance our understanding of both this specific protein and the broader UPF0060 membrane protein family. Future research directions should consider:

• Structural Biology Approaches:

  • High-resolution structure determination using cryo-electron microscopy

  • Investigation of dynamic structural changes using hydrogen-deuterium exchange mass spectrometry

  • Computational molecular dynamics simulations to predict conformational changes in membrane environments

• Functional Characterization:

  • Systematic mutagenesis studies to identify critical functional residues

  • Development of specific inhibitors as research tools and potential therapeutic leads

  • Investigation of post-translational modifications that may regulate function

• System-Level Integration:

  • Comprehensive interactome mapping to position BURPS668_1464 within cellular networks

  • Transcriptional regulation studies under various environmental conditions

  • Development of conditional expression systems to study temporal aspects of function

• Translational Applications:

  • Assessment of BURPS668_1464 as a potential diagnostic biomarker for Burkholderia infection

  • Evaluation as a candidate vaccine antigen for immunization strategies

  • Investigation of structure-based drug design targeting this protein

• Comparative Biology:

  • Systematic comparison with homologous proteins across diverse bacterial species

  • Investigation of evolutionary conservation and divergence patterns

  • Development of model systems for studying conserved functions in non-pathogenic organisms

Researchers pursuing these directions should prioritize integration of multiple experimental approaches and collaborative interdisciplinary efforts to accelerate progress in understanding this intriguing membrane protein and its biological significance in Burkholderia pseudomallei.

How should researchers address data inconsistencies when working with BURPS668_1464 protein across different experimental systems?

When researchers encounter data inconsistencies in BURPS668_1464 studies across different experimental systems, a systematic troubleshooting and reconciliation approach is essential. The following methodological framework is recommended:

• Systematic Documentation and Analysis:

  • Create comprehensive comparison tables documenting all experimental variables

  • Identify pattern-based inconsistencies (e.g., specific to expression systems or buffer conditions)

  • Determine whether inconsistencies are qualitative or quantitative in nature

  • Calculate the magnitude of variation to assess biological versus technical significance

• Controlled Variable Isolation:

  • Design experiments that systematically alter single variables while maintaining others constant

  • Test critical parameters in parallel rather than sequentially to minimize batch effects

  • Implement internal controls specific to each experimental system

  • Consider blind testing protocols to eliminate unconscious experimenter bias

• Method Standardization and Validation:

  • Develop standardized protocols with detailed parameter reporting requirements

  • Validate key findings using orthogonal techniques

  • Establish minimum quality control metrics that must be reported

  • Create reference standard preparations for inter-laboratory comparisons

• Collaborative Resolution Approaches:

  • Organize direct laboratory exchanges or collaborative experiments

  • Implement round-robin testing across multiple research groups

  • Develop consensus protocols through multi-laboratory validation

  • Establish shared repositories of validated materials and reagents

• Transparent Reporting of Reconciliation:

  • Publish comprehensive methodological papers addressing inconsistencies

  • Document both successful and unsuccessful reconciliation attempts

  • Provide raw data access to facilitate independent analysis by other researchers

  • Clearly communicate remaining uncertainties and their implications