Recombinant Burkholderia sp. 4-hydroxybenzoate octaprenyltransferase (ubiA)

Shipped with Ice Packs
In Stock

Description

Introduction to UbiA in Burkholderia Species

The 4-hydroxybenzoate octaprenyltransferase, commonly referred to as UbiA, is an essential enzyme encoded by the ubiA gene in Burkholderia species. In Burkholderia multivorans ATCC 17616, this gene is located on chromosome 1 at position 2899888-2900751 on the negative strand . UbiA belongs to the UbiA superfamily of prenyltransferases that catalyze C-C bond formation between aromatic acceptor molecules and prenyl chains, a crucial step in the biosynthesis of ubiquinone (coenzyme Q) .

Ubiquinone serves as an electron carrier in the respiratory chain and is vital for energy production in bacterial cells. In Burkholderia species, UbiA facilitates the prenylation of 4-hydroxybenzoate (4-HB), an early step in the ubiquinone biosynthesis pathway that is critical for cellular respiration and bacterial survival . This enzyme is widely distributed across various Burkholderia species, including B. multivorans, B. ambifaria, and B. pseudomallei, though its sequence may show minor variations between species.

Table 1: Physical Properties of Burkholderia multivorans UbiA

PropertyValue
Molecular Weight31675.1 Da
Isoelectric Point (pI)9.45
Charge (pH 7)8.06
Kyte-Doolittle Hydrophobicity0.645
Gene LocationChromosome 1, negative strand
Genomic Position2899888-2900751

Biochemical Function of UbiA

The primary function of UbiA in Burkholderia species is to catalyze the prenylation of 4-hydroxybenzoate (4-HB) with octaprenyl pyrophosphate to form 4-hydroxy-3-octaprenylbenzoate (4-H-3-OPB) . This reaction represents a critical early step in the ubiquinone biosynthesis pathway. The enzyme's activity depends on the presence of divalent metal ions, particularly Mg²⁺, which coordinates with the conserved aspartic acid residues in the enzyme's active site .

The biochemical pathway begins with chorismate, which is converted to 4-HB by chorismate pyruvate-lyase (UbiC). Subsequently, UbiA transfers the octaprenyl group from octaprenyl pyrophosphate to 4-HB, forming 4-H-3-OPB. This intermediate then undergoes a series of decarboxylation, hydroxylation, and methylation reactions to ultimately produce ubiquinone-8 (UQ-8), the functional electron carrier in the respiratory chain .

Recent studies have demonstrated that certain small molecules, such as 2,4-dihydroxybenzoxazine (DHB) produced by Photorhabdus bacteria, can interfere with UbiA function. DHB acts as both a competitive inhibitor by binding to UbiA and as a substrate mimic that gets prenylated, forming an unusable chimeric product. This dual mechanism of action represents a novel bacterial competition strategy that could inform antimicrobial development .

Production of Recombinant UbiA

Recombinant production of UbiA from Burkholderia species has been achieved using baculovirus expression systems, which are suitable for membrane-associated proteins . The recombinant protein can be purified to >85% purity as determined by SDS-PAGE analysis . Due to the protein's hydrophobic nature and membrane association, specialized detergents and purification protocols are typically required to maintain its structural integrity and functional activity.

Storage recommendations for recombinant UbiA include avoiding repeated freeze-thaw cycles and reconstituting lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, addition of 5-50% glycerol (final concentration) and storage at -20°C/-80°C is recommended . Under optimal storage conditions, liquid formulations typically have a shelf life of approximately six months, while lyophilized forms can maintain stability for up to twelve months .

UbiA in Cellular Metabolism

UbiA plays a crucial role in bacterial energy metabolism through its involvement in ubiquinone biosynthesis. Ubiquinone (UQ-8 in most Burkholderia species) functions as an electron carrier in the respiratory chain, facilitating aerobic respiration and ATP generation . The importance of this pathway is underscored by the fact that disruption of ubiquinone biosynthesis can severely impair bacterial growth and survival under aerobic conditions.

In Burkholderia species, UbiA is particularly important given their metabolic versatility and ability to thrive in diverse environments. The ubiquinone biosynthesis pathway represents an essential metabolic process that cannot be circumvented, making UbiA a potential target for antimicrobial development. Additionally, the regulation of UbiA expression appears to be influenced by environmental factors, with evidence suggesting that glucose can repress transcription of the ubiA gene .

Inhibition and Regulation of UbiA

Recent research has identified natural inhibitors of UbiA, including 2,4-dihydroxybenzoxazine (DHB) produced by Photorhabdus bacteria. DHB structurally resembles 4-HB and competes for binding to the UbiA active site. Remarkably, DHB exhibits a dual mechanism of inhibition: it both prevents the binding of the natural substrate 4-HB and serves as a substrate itself, becoming prenylated to form an unusable product that likely contributes to its toxicity .

The regulation of UbiA activity appears to involve multiple mechanisms. At the transcriptional level, glucose has been identified as a repressor of ubiA transcription, suggesting metabolic control of enzyme expression . Additionally, the cellular levels of 4-HB, UbiA's substrate, are controlled by the AaeAB efflux pump in some bacteria. Experiments have shown that overexpression of aaeB decreases sensitivity to DHB inhibition, while deletion of aaeB increases the amount of intracellular 4-HB and confers resistance to DHB, indicating competition between 4-HB and DHB for UbiA binding sites .

Table 2: Factors Affecting UbiA Activity

FactorEffect on UbiA Activity
Mg²⁺, Ca²⁺, Na⁺, K⁺Enhanced enzymatic activity
Mn²⁺, Zn²⁺Inhibition of activity
EDTA, 1,10-phenanthrolineInhibition (likely by chelating essential metal ions)
DHBCompetitive inhibition and substrate mimic
GlucoseRepression of ubiA transcription
4-HB concentrationCompetes with inhibitors like DHB

Comparative Analysis with Homologs

When compared to human homologs, UbiA from B. multivorans shows approximately 32.8% sequence identity with human coenzyme Q2 polyprenyltransferase . This moderate level of conservation reflects the evolutionary distance between bacterial and human proteins while suggesting functional similarities in the core catalytic mechanism. The significant differences between bacterial and human enzymes provide potential opportunities for selective targeting in antimicrobial development.

The UbiA superfamily extends beyond Burkholderia to many other bacterial genera. Recent investigations have identified novel UbiA-like prenyltransferases in marine Flavobacteria and the genus Sacchromonospora, such as Ubi-297, which demonstrate preferences for different aromatic substrates, including quinoline derivatives . This diversity highlights the evolutionary adaptability of UbiA-like enzymes across bacterial taxa.

Research Applications and Future Directions

The recombinant UbiA from Burkholderia species has several potential research and biotechnological applications. As a critical enzyme in bacterial metabolism that differs significantly from human homologs, UbiA represents a promising target for novel antimicrobial development. The discovery that DHB targets UbiA through a dual mechanism of competitive inhibition and substrate mimicry provides a model for designing new antibacterial compounds with similar mechanisms .

Additionally, the prenylation activity of UbiA and related enzymes has biotechnological potential in the synthesis of prenylated aromatic compounds, which often exhibit enhanced biological activities due to increased lipophilicity and improved binding abilities to target proteins . Further research into the substrate scope and reaction conditions of recombinant UbiA could expand its applications in biocatalysis.

Future research directions might include:

  1. Detailed structural studies of UbiA, including crystal structures with various substrates and inhibitors

  2. Development of selective UbiA inhibitors as potential antibiotics against Burkholderia infections

  3. Engineering UbiA variants with altered substrate specificities for biotechnological applications

  4. Investigation of the role of UbiA in bacterial pathogenesis and stress responses

  5. Exploration of UbiA as a potential vaccine target for Burkholderia infections

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, kindly indicate them in your order. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: Our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which you can use as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and protein stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Please note: The tag type will be decided during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ubiA; Bcep18194_A3815; 4-hydroxybenzoate octaprenyltransferase; 4-HB polyprenyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-287
Protein Length
full length protein
Species
Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Target Names
ubiA
Target Protein Sequence
MLARFPLYLRLVRMDKPIGSLLLLWPTLNALWIASDGHPRWPLLVIFSLGTLLMRSAGCA MNDYADRDFDRHVKRTADRPLTSGKIRAWEAIAIAVGLAFVSFLLILPLNTLTKQLSVVA LFVAGSYPFMKRFFAIPQAYLGIAFGFGIPMAFAAVQDTVPTIAWVMLIANIFWSVAYDT EYAMVDRDDDIKIGIRTSALTFGRFDVAAVMLCYAVTLGIYVWIGVTLGFGLAYWAGWAA AVGCALYHYTLIKDRERMPCFAAFRHNNWLGGVLFAGIAAHYLLAGS
Uniprot No.

Target Background

Function
This enzyme catalyzes the prenylation of para-hydroxybenzoate (PHB) with an all-trans polyprenyl group. It plays a crucial role in the final stage of ubiquinone-8 (UQ-8) biosynthesis by mediating the second step. This step involves the condensation of the polyisoprenoid side chain with PHB, resulting in the formation of the first membrane-bound Q intermediate, 3-octaprenyl-4-hydroxybenzoate.
Database Links
Protein Families
UbiA prenyltransferase family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is 4-hydroxybenzoate octaprenyltransferase (UbiA) and what is its role in Burkholderia species?

4-hydroxybenzoate octaprenyltransferase (UbiA) is a membrane-bound enzyme belonging to the UbiA prenyltransferase domain-containing family that catalyzes the prenylation of 4-hydroxybenzoate (4HBA) with an octaprenyl diphosphate to form 3-octaprenyl-4-hydroxybenzoate, a critical intermediate in ubiquinone (coenzyme Q) biosynthesis. In Burkholderia species, UbiA is essential for respiratory chain function and energy metabolism, contributing to the organism's metabolic versatility in diverse environments . The UbiA protein typically exhibits a molecular weight of approximately 60 kDa as verified through western blotting techniques . Within Burkholderia's genome, the UbiA gene is generally conserved, reflecting its fundamental metabolic importance.

What expression systems are most effective for recombinant Burkholderia UbiA production?

For recombinant Burkholderia UbiA production, eukaryotic expression systems have demonstrated significant success. Based on experimental evidence with related proteins, the PUAST vector system has proven particularly effective. This approach involves initial cloning into a mammalian expression vector (such as pcDNA3) followed by subcloning into the PUAST vector for expression in eukaryotic cells like Drosophila S2 cells . This method has several advantages:

  • Higher protein yields compared to prokaryotic systems

  • Proper post-translational modifications

  • Improved protein folding for membrane-associated proteins like UbiA

The experimental workflow typically involves:

  • PCR amplification of the UbiA gene with primers containing appropriate restriction sites

  • Cloning into an intermediate vector (e.g., pcDNA3)

  • Confirmation through restriction digestion and sequencing

  • Subcloning into the final expression vector (PUAST)

  • Transfection into S2 cells for protein expression

  • Verification through western blotting

This systematic approach has yielded significant amounts of functional protein with approximately 99% sequence identity to the original gene .

How can researchers optimize the purification of recombinant Burkholderia UbiA?

Purification of recombinant Burkholderia UbiA presents significant challenges due to its membrane-bound nature. An effective purification strategy should incorporate these methodological considerations:

  • Membrane extraction optimization: Use mild detergents like n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) that maintain protein structure while solubilizing the membrane.

  • Affinity tag selection: For UbiA purification, a dual tag approach using His6 at the N-terminus and a Strep-tag at the C-terminus allows for sequential affinity purification steps, significantly enhancing purity.

  • Chromatography sequence:

    • Initial capture using immobilized metal affinity chromatography (IMAC)

    • Intermediate purification using ion exchange chromatography

    • Polishing step using size exclusion chromatography

  • Stability considerations: Throughout purification, maintain a stable environment with appropriate pH (typically 7.5-8.0), salt concentration (300-500 mM NaCl), and glycerol (10-20%) to prevent aggregation.

Western blotting techniques can verify purification success, with properly purified UbiA appearing as a singular band at approximately 60 kDa . Researchers should note that yield optimization often requires empirical testing of different detergent concentrations and buffer compositions specific to Burkholderia UbiA.

What are common challenges in expressing functional Burkholderia UbiA and how can they be addressed?

Expressing functional Burkholderia UbiA presents several challenges that researchers must address through systematic experimental approaches:

  • Membrane protein solubility issues:

    • Challenge: UbiA is a membrane-associated prenyltransferase that often forms inclusion bodies when overexpressed.

    • Solution: Use fusion tags like MBP (maltose-binding protein) or SUMO to enhance solubility; optimize induction conditions with lower temperatures (16-20°C) and reduced inducer concentrations.

  • Preserving enzymatic activity:

    • Challenge: Maintaining the native structure and function during recombinant expression.

    • Solution: Expression in eukaryotic systems like S2 cells has shown success with 99% sequence identity to native proteins . Co-expression with chaperone proteins can further improve folding.

  • Substrate availability:

    • Challenge: UbiA requires both 4-hydroxybenzoate and prenyl diphosphate substrates for activity assessment.

    • Solution: Synthesize or source high-purity substrates; consider stable analogs for initial screenings.

  • Validation of functional activity:

    • Challenge: Confirming the recombinant enzyme produces the expected products.

    • Solution: Employ analytical techniques like HPLC-MS with standards showing characteristic retention times and mass spectra patterns similar to those documented for 4HBA and its derivatives (e.g., butyl 4HBA at 20.8 min retention time with m/z peaks including 266 (M+)) .

Successful expression strategies have been demonstrated using vectors like PUAST in eukaryotic cell systems that provide the complex cellular machinery necessary for proper folding and function of membrane proteins like UbiA .

How does UbiA contribute to Burkholderia species' environmental adaptability?

Burkholderia species demonstrate remarkable environmental adaptability, with UbiA playing a critical role in this versatility. The enzyme's contribution operates through several interrelated mechanisms:

  • Metabolic flexibility: UbiA's role in ubiquinone biosynthesis supports Burkholderia's ability to utilize diverse carbon sources. This species can metabolize sugars through multiple pathways (ED, PP, and EMP) as well as fatty acids via β-oxidation , allowing survival in nutrient-variable environments.

  • Environmental stress response: Ubiquinone, produced through the UbiA pathway, functions as:

    • An essential electron carrier in respiratory chains

    • An antioxidant that protects against oxidative stress in changing environments

    • A membrane stabilizer that aids adaptation to temperature and pH fluctuations

  • Ecological niche exploitation: Burkholderia species are found globally in soil and aquatic environments, particularly in tropical and subtropical regions . Their metabolic capabilities enable them to:

    • Remove hydrocarbon contaminants from ground water and soil

    • Produce bioactive compounds like 4-hydroxybenzoate (4HBA) that may provide competitive advantages

    • Fight plant infections, positioning them as potential biocontrol agents

This adaptive capability is particularly significant as Burkholderia species coinhabit soil environments with other bacteria, establishing complex ecological interactions . Understanding UbiA's role in these adaptations provides insights into Burkholderia's ecological success and potential biotechnological applications.

What is the relationship between UbiA function and antibiotic resistance in Burkholderia species?

The relationship between UbiA function and antibiotic resistance in Burkholderia species represents a complex but critical area of research. Several interconnected mechanisms suggest UbiA may contribute to the notable antibiotic resistance observed in Burkholderia:

Understanding these relationships could inform strategies to address antibiotic resistance in pathogenic Burkholderia species that cause serious infections, particularly in immunocompromised individuals.

How can UbiA be engineered for enhanced catalytic properties or novel substrate specificity?

Engineering Burkholderia UbiA for enhanced catalytic properties or novel substrate specificity requires a systematic approach combining structural insights with directed evolution techniques. Researchers can pursue several methodological strategies:

  • Structure-guided mutagenesis:

    • Target the active site residues that coordinate substrate binding based on crystallographic or homology modeling data

    • Introduce mutations that alter the binding pocket dimensions to accommodate alternative substrates

    • Modify residues involved in catalysis to enhance reaction rates

  • Directed evolution approaches:

    • Employ error-prone PCR to generate libraries of UbiA variants

    • Develop high-throughput screening assays to identify variants with desired properties

    • Use DNA shuffling between UbiA homologs from different Burkholderia species to combine beneficial properties

  • Substrate engineering considerations:

    • Modify the length of the prenyl diphosphate substrate recognition region

    • Alter the aromatic substrate binding region to accept derivatives beyond 4-hydroxybenzoate

    • Consider the natural diversity of 4HBA derivatives already observed in Burkholderia species, including butyl 4HBA (retention time 20.8 min), heptyl 4HBA (24.0 min), and nonyl 4HBA (26.0 min)

  • Expression system optimization:

    • Use the PUAST vector system in eukaryotic cells for proper expression of engineered variants

    • Validate protein production through western blotting techniques

    • Ensure engineered variants maintain proper folding with expected molecular weight (~60 kDa)

Such engineering efforts could lead to enzymes capable of producing novel bioactive compounds or improving the efficiency of existing biosynthetic pathways in Burkholderia species.

What are the most effective methods for assaying UbiA enzymatic activity?

Assaying UbiA enzymatic activity requires sensitive and specific analytical techniques due to the membrane-bound nature of the enzyme and the hydrophobicity of its substrates and products. The following comprehensive methodological approach is recommended:

  • Radiometric assays:

    • Substrate preparation: Use 14C-labeled 4-hydroxybenzoate and unlabeled octaprenyl diphosphate

    • Reaction conditions: pH 7.5-8.0, 30-37°C, with appropriate detergent (0.1% DDM)

    • Analysis: Separate products by thin-layer chromatography and quantify using scintillation counting

    • Advantage: High sensitivity for detecting even low enzymatic activity

  • HPLC-based methods:

    • Substrate preparation: Mix purified recombinant UbiA with 4HBA and octaprenyl diphosphate

    • Reaction extraction: Use organic solvents (ethyl acetate/hexane)

    • Analysis: Reversed-phase HPLC with UV detection at 254nm

    • Product identification: Compare retention times with standards (e.g., 4HBA derivatives have characteristic retention times: 4HBA at 19.1 min, butyl 4HBA at 20.8 min)

  • LC-MS/MS quantification:

    • Sample preparation: Derivatize products with trimethylsilyl groups

    • Analysis: Monitor characteristic m/z transitions (e.g., 4HBA-TMS shows m/z peaks including 282 (M+), 267, 223)

    • Quantification: Create standard curves using authenticated standards

    • Data interpretation: Compare mass spectral patterns with reference data

  • Kinetic parameter determination:

    • Measure initial reaction rates at varying substrate concentrations

    • Plot data using Michaelis-Menten kinetics to determine Km and Vmax

    • Calculate catalytic efficiency (kcat/Km) to compare enzyme variants

These methods provide complementary approaches to comprehensively characterize UbiA activity, with the choice depending on available equipment and specific research questions.

How can researchers effectively analyze the structure-function relationship of Burkholderia UbiA?

Analyzing the structure-function relationship of Burkholderia UbiA requires an integrated approach combining computational, biochemical, and biophysical techniques. Researchers should implement the following methodological framework:

  • Computational analysis:

    • Homology modeling: Generate structural models of Burkholderia UbiA based on crystallized homologs

    • Molecular dynamics simulations: Examine protein flexibility and substrate interactions

    • Sequence conservation analysis: Identify highly conserved residues across UbiA enzymes from different species

    • Docking studies: Predict binding modes of substrates and inhibitors

  • Site-directed mutagenesis:

    • Target conserved residues identified through computational analysis

    • Create systematic alanine scanning mutagenesis across predicted functional domains

    • Generate chimeric proteins combining domains from different UbiA homologs

    • Express variants using the PUAST vector system in eukaryotic cells for proper folding

  • Functional characterization:

    • Activity assays: Measure kinetic parameters of wild-type and mutant enzymes

    • Substrate specificity profiling: Test activity with different prenyl diphosphates and aromatic substrates

    • Product analysis: Use LC-MS/MS to identify and quantify reaction products

  • Biophysical techniques:

    • Circular dichroism: Assess secondary structure changes in mutant proteins

    • Thermal shift assays: Evaluate stability of protein variants

    • Limited proteolysis: Map domain boundaries and flexible regions

  • Structural validation:

    • X-ray crystallography or cryo-EM: Determine high-resolution structures when possible

    • Crosslinking mass spectrometry: Map spatial relationships between protein domains

This comprehensive approach enables researchers to correlate structural features with enzymatic function, providing insights for protein engineering and inhibitor design.

What bioinformatic approaches can advance our understanding of UbiA evolution across Burkholderia species?

Bioinformatic approaches offer powerful tools for investigating UbiA evolution across Burkholderia species, revealing patterns of conservation, adaptation, and potential functional divergence. Researchers should employ these methodological strategies:

  • Comparative genomic analysis:

    • Genome mining: Identify and extract UbiA sequences from all available Burkholderia genomes

    • Synteny analysis: Examine conservation of gene neighborhoods around UbiA

    • Copy number variation: Determine if UbiA exhibits gene duplication patterns similar to other metabolic genes in Burkholderia (such as phaC, which is generally present in ≥2 copies)

    • Horizontal gene transfer assessment: Identify potential instances of UbiA acquisition across species boundaries

  • Phylogenetic reconstruction:

    • Multiple sequence alignment: Align UbiA sequences using MUSCLE or MAFFT algorithms

    • Tree building: Construct maximum likelihood or Bayesian phylogenetic trees

    • Divergence time estimation: Calculate when UbiA variants emerged in different Burkholderia lineages

    • Correlation with ecological niches: Map evolutionary patterns to habitat transitions (soil, water, host-associated)

  • Selection pressure analysis:

    • Calculate dN/dS ratios across the UbiA gene to identify regions under purifying or positive selection

    • Site-specific selection analysis to pinpoint functionally important residues

    • Branch-site tests to detect episodic selection in specific Burkholderia lineages

    • Compare selection patterns between pathogenic and non-pathogenic Burkholderia species

  • Protein domain architecture analysis:

    • Identify conserved domains using tools like InterProScan

    • Analyze domain organization changes across evolutionary time

    • Correlate domain structure with functional specificity

  • Co-evolution network analysis:

    • Identify proteins that co-evolve with UbiA, suggesting functional interactions

    • Construct metabolic networks centered on UbiA function

    • Analyze the evolution of connected pathways across species

These bioinformatic approaches reveal how UbiA has evolved within the metabolically versatile Burkholderia genus, providing insights into adaptation mechanisms and potential biotechnological applications.

How might recombinant Burkholderia UbiA be utilized for biotechnological applications?

Recombinant Burkholderia UbiA offers significant potential for diverse biotechnological applications due to its enzymatic capabilities and the growing interest in sustainable bioproduction systems. Several promising application directions include:

  • Bioproduction of high-value compounds:

    • Synthesis of ubiquinone (Coenzyme Q) derivatives for pharmaceutical applications

    • Production of prenylated aromatic compounds with antimicrobial or antioxidant properties

    • Biosynthesis of 4-hydroxybenzoate derivatives currently produced through chemical synthesis

    • Generation of parabens (alkyl esters of 4HBA) used as preservatives in food and cosmetic industries

  • Bioremediation technologies:

    • Engineering recombinant systems for enhanced degradation of environmental pollutants

    • Leveraging Burkholderia's natural ability to remove hydrocarbon contaminants from groundwater and soil

    • Developing biosensors for environmental monitoring based on UbiA activity

  • Agricultural applications:

    • Creating biocontrol agents against plant pathogens, building on Burkholderia's demonstrated capacity to fight plant infections

    • Developing plant growth-promoting formulations through metabolic engineering of Burkholderia

    • Engineering drought or stress resistance through modified ubiquinone biosynthesis

  • Protein engineering platforms:

    • Using the PUAST vector system demonstrated effective for UbiA expression to develop enhanced biocatalysts

    • Creating chimeric enzymes with novel substrate specificities

    • Developing high-throughput screening systems for directed evolution of prenyltransferases

Implementation of these applications would build upon established methodologies for recombinant UbiA production, including eukaryotic expression systems that yield properly folded, active enzyme with approximately 99% sequence identity to the native protein .

What are the most promising research directions for understanding the broader metabolic context of UbiA in Burkholderia species?

Understanding the broader metabolic context of UbiA in Burkholderia species presents several promising research directions that could significantly advance both fundamental knowledge and biotechnological applications:

These research directions would benefit from the established methodologies for recombinant UbiA expression using systems like the PUAST vector while expanding our understanding of this enzyme's role in Burkholderia's remarkable metabolic flexibility.

What experimental approaches can help determine the in vivo significance of UbiA in Burkholderia species?

Determining the in vivo significance of UbiA in Burkholderia species requires comprehensive experimental approaches that bridge molecular techniques with physiological and ecological studies. Researchers should consider implementing these methodological strategies:

  • Genetic manipulation approaches:

    • Gene knockout/knockdown: Create UbiA deletion mutants using CRISPR-Cas9 or homologous recombination

    • Conditional expression systems: Develop inducible promoters to control UbiA expression levels

    • Complementation studies: Reintroduce wild-type or mutant UbiA to evaluate phenotype rescue

    • Site-directed mutagenesis: Create point mutations in chromosomal UbiA to assess specific residue functions

  • Physiological characterization:

    • Growth profiling: Compare growth rates of wild-type and UbiA mutants under various conditions

    • Metabolic flexibility assessment: Evaluate ability to utilize different carbon sources across ED, PP, and EMP pathways

    • Stress response analysis: Test resistance to oxidative, temperature, pH, and nutrient stress

    • Respiration measurements: Quantify oxygen consumption rates to assess respiratory chain function

  • Biochemical analyses:

    • Ubiquinone quantification: Measure levels using HPLC-MS in wild-type versus mutant strains

    • Metabolomic profiling: Identify metabolic shifts resulting from UbiA perturbation

    • Membrane composition analysis: Evaluate changes in lipid profiles and membrane properties

    • Electron transport chain activity: Measure complex activities in membrane preparations

  • Environmental and ecological studies:

    • Soil and rhizosphere colonization: Compare persistence of wild-type and UbiA mutants

    • Biofilm formation capacity: Assess structural differences and stability

    • Interspecies competition assays: Evaluate competitive fitness in mixed microbial communities

    • Plant interaction studies: Measure plant growth promotion or pathogen protection capabilities

  • Host interaction models (for relevant species):

    • Infection models: Assess virulence of UbiA mutants in appropriate host systems

    • Antimicrobial resistance profiles: Determine how UbiA affects resistance to clinically relevant antibiotics

    • Immune response elicitation: Measure host immune parameters during interaction with mutants

These approaches provide a comprehensive framework for understanding UbiA's significance across molecular, cellular, and ecological scales in the remarkably adaptable Burkholderia species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.