Recombinant Burkholderia sp. Bifunctional protein glk (glk)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Burkholderia sp. Bifunctional Protein glk (glk)

The Recombinant Burkholderia sp. Bifunctional protein glk (glk) is a protein expressed in Escherichia coli and derived from the Burkholderia genus. This protein is notable for its bifunctional nature, incorporating both glucokinase and glucose kinase activities, as well as a putative HTH-type transcriptional regulator function . The Burkholderia genus is diverse, encompassing both pathogenic and non-pathogenic species, and is known for its metabolic versatility and ecological adaptability .

Glycosylation in Burkholderia Species

While the Recombinant Burkholderia sp. Bifunctional protein glk (glk) itself is not directly involved in glycosylation, the Burkholderia genus is known for its conserved glycosylation patterns. Specifically, O-linked glycosylation is prevalent and targets Serine residues across various Burkholderia species . This glycosylation is crucial for protein stability and function in some cases but is not universally required for all glycoproteins .

Biosynthetic Gene Clusters in Burkholderia

The Burkholderia genus is rich in biosynthetic gene clusters (BGCs), which are potential sources of novel compounds. Techniques like recombineering have been used to activate silent BGCs, leading to the discovery of new lipopeptides with potential pharmaceutical applications .

ELISA Kits for Detection

ELISA kits are available for detecting the Recombinant Burkholderia sp. Bifunctional protein glk (glk), facilitating research into its expression and function .

References Creative Biomart. Recombinant Full Length Burkholderia sp. Bifunctional protein glk(glk) Protein (Q39IQ1) (1-642aa), fused to N-terminal His tag, was expressed in E. coli. PubMed. Glycoproteomic and proteomic analysis of Burkholderia cenocepacia. PMC. Genomics-Driven Activation of Silent Biosynthetic Gene Clusters in Burkholderia gladioli. PMC. Burkholderia PglL enzymes are Serine preferring oligosaccharyltransferases. PMC. Glycoproteomic and proteomic analysis of Burkholderia cenocepacia. PMC. Burkholderia multivorans requires species‐specific GltJK for entry of a contact‐dependent growth inhibition system protein. CBM15. ELISA Recombinant Burkholderia sp. Bifunctional protein glk(glk).

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
glk; Bcep18194_A4068; Bifunctional protein glk [Includes: Glucokinase; Glucose kinase; Putative HTH-type transcriptional regulator]
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-642
Protein Length
full length protein
Species
Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Target Names
glk
Target Protein Sequence
MSTGAQSKAAVAGQHADGPRLLADVGGTNARFALETGPGDITQIRVYPGADYPTLTDAIR KYLKDVKITRVNHAAIAIANPVDGDQVTMTNHDWSFSIEATRRALGFDTLLVVNDFTALA MALPGLTDAQRVQIGGGARRQNSVIGLLGPGTGLGVSGLIPADDRWIALGSEGGHASFAP QDEREDLVLQYARKKFPHVSFERVCAGPGMEIIYRALAARDKKRVAATVDTVEIVERAHA GDALALETVECFCGILGAFAGSVALTLGALGGVYIGGGVALKLGELFTRSSFRARFEAKG RFTHYLENIPTYLITAEYPAFLGVSAILAEQLSNRSGGASSAVFERIRQMRDALTPAERR VADLALNHPRSIINDPIVDIARKADVSQPTVIRFCRSLGCQGLSDFKLKLATGLTGTIPM SHSQVHLGDTATDFGAKVLDNTVSAILQLREHLNFEHVENAIEILNGARRIEFYGLGNSN IVAQDAHYKFFRFGIPTIAYGDLYMQAASAALLGKGDVIVAVSKSGRAPELLRVLDVAMQ AGAKVIAITSSNTPLAKRATVALETDHIEMRESQLSMISRILHLLMIDILAVGVAIRRAS TNGELPEAVAQAKARASDDETADVLDWLSHGASPAAKDVARD
Uniprot No.

Target Background

Database Links
Protein Families
Bacterial glucokinase family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the bifunctional nature of the glk protein in Burkholderia species?

The glk protein in Burkholderia species demonstrates bifunctional properties, similar to other bifunctional enzymes found in bacterial systems. While specific characterization of Burkholderia glk's dual functions requires further study, research on other bifunctional enzymes shows that strategic design of peptide linkers can significantly enhance enzymatic activities. For example, studies on beta-glucanase-xylanase (Glu-Xyl) fusion enzymes demonstrate that using optimized peptide linkers such as (GGGGS)₂ can increase catalytic efficiency by up to 326% for one function and 43% for the other, compared to parental enzymes . This suggests that proper linker design is crucial when expressing and studying bifunctional proteins like glk.

What expression systems are most suitable for recombinant Burkholderia glk protein production?

Escherichia coli BL21DE3 has been successfully used as a host for expressing recombinant proteins from related bacterial species. For instance, the glucokinase (r-glk) gene from Brucella abortus S19 was effectively cloned and expressed in this system . When expressing Burkholderia proteins, considerations should include:

  • Codon optimization for E. coli if needed

  • Selection of appropriate induction systems

  • Optimization of growth conditions (temperature, media, induction timing)

  • Inclusion of appropriate purification tags (His-tag, GST, etc.)

For Burkholderia proteins specifically, heterologous expression has been successful for various natural products, including lasso peptides and polyketide-nonribosomal peptides in E. coli systems .

How does protein glycosylation affect Burkholderia protein function and structure?

Glycosylation is a critical post-translational modification in Burkholderia species that can significantly impact protein function and structure. Recent glycoproteomic studies reveal that PglL enzymes of the Burkholderia genus are Serine-preferring oligosaccharyltransferases with high specificity. In B. cenocepacia strains K56-2 and H111, glycosylation occurs exclusively at Serine residues, with glycoproteins and glycosylation sites being highly conserved across isolates .

This site-specificity extends across the Burkholderia genus—in glycoproteomic analyses of eight different Burkholderia species, only 11 out of 440 high-confidence glycosylation sites were localized to Threonine, with the vast majority occurring at Serine residues . When expressing recombinant Burkholderia proteins, researchers should consider how glycosylation might affect function, especially if expression occurs in a system lacking appropriate glycosylation machinery.

What strategies exist for engineering enhanced bifunctionality in recombinant Burkholderia glk proteins?

Engineering enhanced bifunctionality in Burkholderia glk proteins requires sophisticated design strategies focused on:

A methodical approach involves creating a matrix of constructs with varied linkers and domain orientations, followed by comprehensive kinetic analysis of each variant to identify optimal configurations.

How can recombinant Burkholderia glk protein be engineered for potential therapeutic applications?

Engineering recombinant Burkholderia glk protein for therapeutic applications requires multifaceted considerations:

  • Immunogenicity assessment: Studies with recombinant proteins from related bacteria show that immunization can produce specific antibody responses. For example, female BALB/c mice immunized with purified recombinant r-glk protein from B. abortus developed specific antibody titers of 1:64,000 with predominant IgG2a and IgG2b isotypes, signifying development of Th1-directed immune responses .

  • Protection evaluation: Therapeutic potential requires rigorous protection studies. In challenge experiments, mice immunized with r-glk protein and challenged with B. abortus 544 showed significant protection with no signs of necrosis or vacuolization in liver and spleen tissues compared to control groups .

  • Stabilization strategies: Protein engineering approaches may include modifications to enhance stability and half-life in therapeutic contexts.

  • Delivery optimization: Development of appropriate formulations and delivery methods to maximize therapeutic efficacy.

The promising results from related bacterial proteins suggest potential applications for properly engineered Burkholderia proteins.

What genetic modification techniques are most effective for studying Burkholderia glk gene function?

Multiple genetic modification techniques have proven effective for studying gene function in Burkholderia species:

TechniqueApplicationsExamples in Burkholderia
Traditional homologous recombinationGene knockoutsApplied in studies of spliceostatins, rhizoxin, malleobactin, and fragin
Red/ET recombinationGene knockoutsUsed to confirm BGCs encoding for haereogladin and burriogladin production
Flp-FRT recombinationGenerating mutantsEmployed in thailandepsin investigation
Promoter exchangePathway activationUsed with rhamnose-inducible promoter and constitutive promoters to activate malleilactone/burkholderic acid pathway
Transposon mutagenesisFunctional studiesApplied in investigations of enacyloxin, thailandamide, ornibactin, and bulgecin BGCs
Heterologous expressionNatural product discoveryUsed for lasso peptide capistruin, polyketide-nonribosomal peptide glidobactin in E. coli

Selection of the appropriate technique depends on the specific research question, the Burkholderia strain being studied, and the desired outcome.

What are the critical considerations for designing cloning strategies for Burkholderia glk genes?

Designing effective cloning strategies for Burkholderia glk genes requires attention to several critical factors:

  • Target selection: Burkholderia genomes are large with multiple replicons. Careful bioinformatic analysis is necessary to identify the correct glk gene within the genome, considering potential paralogs.

  • Vector selection: Based on research objectives, choose between expression vectors (for protein production), shuttle vectors (for complementation studies), or specialized vectors for genetic manipulation.

  • Codon optimization: Burkholderia has a high GC content (approximately 67%), which may necessitate codon optimization when expressing in heterologous hosts like E. coli.

  • Fusion tags consideration: Strategic placement of affinity or solubility tags can enhance expression and purification. For bifunctional proteins, tag placement must not interfere with either functional domain.

  • Regulatory elements: Selection of appropriate promoters and ribosome binding sites influences expression levels. For Burkholderia proteins, both native promoters and heterologous promoters like P₁ arabinose-inducible promoter have been successfully used .

  • Restriction site selection: Avoid restriction sites present within the gene of interest, and consider adding appropriate sites for subsequent subcloning or manipulation.

A thorough examination of the target gene sequence using bioinformatic tools prior to experimental design significantly improves success rates.

What purification methods yield the highest purity and activity for recombinant Burkholderia glk proteins?

Optimizing purification of recombinant Burkholderia glk proteins requires a strategic multi-step approach:

  • Initial clarification: After cell lysis (typically via sonication or French press), centrifugation at 10,000-15,000g for 30-45 minutes removes cellular debris.

  • Affinity chromatography: For His-tagged constructs, immobilized metal affinity chromatography (IMAC) using Ni-NTA resin is typically employed with a step gradient of imidazole (20mM wash, 250-500mM elution).

  • Ion exchange chromatography: Based on the theoretical pI of the glk protein, select appropriate ion exchange media (anion or cation) for further purification.

  • Size exclusion chromatography: As a final polishing step, size exclusion chromatography in a buffer optimized for protein stability separates any remaining contaminants and aggregates.

  • Activity preservation: Throughout purification, maintain conditions that preserve bifunctional activity:

    • Include glycerol (10-15%) to stabilize protein structure

    • Add reducing agents like DTT or β-mercaptoethanol if cysteine residues are present

    • Consider including cofactors or substrate analogs if they enhance stability

Monitor protein purity via SDS-PAGE and activity through specific enzymatic assays at each purification step to track purification efficiency and activity recovery.

How can researchers assess the dual functionality of recombinant Burkholderia glk protein?

Assessment of dual functionality requires methodical characterization of each function independently and in combination:

  • Kinetic parameter determination: For each function, determine:

    • Substrate specificity range

    • K<sub>m</sub> values for each substrate

    • k<sub>cat</sub> and catalytic efficiency (k<sub>cat</sub>/K<sub>m</sub>)

    • Optimal pH and temperature conditions

  • Domain interaction analysis: Assess whether activities are:

    • Independent of each other

    • Synergistic (enhancing each other)

    • Antagonistic (one domain inhibiting the other)

  • Comparative analysis with monofunctional controls: Express each domain separately and compare activities with the bifunctional protein to calculate enhancement or reduction factors.

  • Structural studies correlation: Techniques like circular dichroism (CD), fluorescence spectroscopy, and ideally X-ray crystallography or cryo-EM can provide insights into how structure influences dual functionality.

Research on other bifunctional enzymes demonstrates that proper design can enhance activities substantially—up to 426% for one function compared to parental enzymes . This suggests that optimal spacing and orientation between functional domains are critical for maximizing both activities.

How should researchers interpret contradictory activity data for recombinant Burkholderia glk proteins?

When encountering contradictory activity data for recombinant Burkholderia glk proteins, implement this systematic approach:

  • Experimental variables assessment:

    • Expression conditions (temperature, induction time, media composition)

    • Purification methods and buffer compositions

    • Storage conditions and freeze-thaw cycles

    • Assay conditions (pH, temperature, cofactor concentrations)

  • Protein quality verification:

    • Confirm protein integrity via SDS-PAGE and Western blot

    • Assess aggregation state using size exclusion chromatography or dynamic light scattering

    • Verify correct folding using circular dichroism

  • Post-translational modification analysis:

    • Glycosylation analysis is particularly important as Burkholderia proteins show specific glycosylation patterns predominantly at Serine residues

    • Phosphorylation state may affect activity

  • Statistical robustness evaluation:

    • Apply appropriate statistical tests to determine if differences are significant

    • Calculate confidence intervals for all measurements

    • Perform power analysis to ensure sufficient replication

  • Independent verification:

    • Test activity using multiple, orthogonal assay methods

    • Consider differential impacts of assay components on each functional domain

When reporting contradictory results, clearly document all experimental conditions to enable reproducibility and facilitate resolution of discrepancies.

What bioinformatic approaches are most valuable for analyzing Burkholderia glk sequence conservation and predicting functional domains?

Comprehensive bioinformatic analysis of Burkholderia glk requires a multi-faceted approach:

  • Sequence conservation analysis:

    • Multiple sequence alignment across Burkholderia species reveals evolutionary conservation patterns

    • Conservation mapping onto structural predictions identifies functionally critical residues

    • Phylogenetic analysis places the protein in evolutionary context

  • Domain prediction and analysis:

    • Tools like InterPro, Pfam, and SMART identify recognized domains

    • Hidden Markov Model (HMM) approaches can detect more distant relationships

    • Structure prediction with AlphaFold2 provides domain organization insights

  • Functional site prediction:

    • Active site prediction based on conserved catalytic residues

    • Substrate binding pocket analysis

    • Potential regulatory sites identification

  • Glycosylation site prediction:

    • Focus on Serine residues as primary targets based on evidence that Burkholderia PglL enzymes strongly prefer Serine

    • Analyze sequence contexts surrounding Serine residues

    • Compare with experimentally verified glycosylation sites in related proteins

  • Cross-species variation analysis:

    • Comparison across Burkholderia species reveals genus-specific patterns

    • Examination of variants may identify species-specific adaptations

This systematic approach provides a foundation for experimental design and interpretation of functional studies.

How does the genomic context of the glk gene in different Burkholderia species inform functional predictions?

The genomic context analysis of Burkholderia glk genes yields valuable insights into functional roles and regulatory mechanisms:

  • Operonic structure analysis:

    • Determine if glk is part of an operon

    • Identify co-transcribed genes that might be functionally related

    • Map transcriptional start sites and terminators

  • Regulatory element identification:

    • Analyze promoter regions for transcription factor binding sites

    • Identify potential riboswitches or attenuators

    • Map small RNA binding sites that might regulate expression

  • Comparative genomics approach:

    • Assess synteny (gene order conservation) across Burkholderia species

    • Identify genomic islands or horizontally transferred regions containing glk

    • Compare with related genera to distinguish genus-specific features

  • Metabolic pathway mapping:

    • Place glk in the context of metabolic pathways

    • Identify potential metabolic partners and substrates

    • Model flux through pathways involving glk

  • Environmental adaptation correlation:

    • Link genomic context variations to ecological niches

    • Correlate with host-association patterns (plant, animal, or human)

    • Analyze in the context of pathogenic vs. non-pathogenic lifestyle

Burkholderia genomes are remarkably large with multiple replicons and significant plasticity, which translates into remarkable phenotypic diversity . This genomic architecture provides important context for understanding glk function across different ecological niches.

What potential does recombinant Burkholderia glk protein have as a vaccine candidate?

Based on research with related bacterial proteins, recombinant Burkholderia glk shows promising vaccine potential that warrants investigation:

  • Immunogenicity evidence: Studies with recombinant glucokinase (r-glk) from B. abortus demonstrated substantial immunogenic properties, with immunized mice developing specific antibody titers of 1:64,000 . The predominant IgG2a and IgG2b isotypes indicated development of Th1-directed immune responses, which are critical for protection against intracellular pathogens .

  • Protective efficacy indicators: In challenge experiments, mice immunized with r-glk protein and then challenged with virulent B. abortus 544 were significantly protected, showing no signs of necrosis or vacuolization in liver and spleen tissues compared to control groups . This demonstrates the potential protective capacity of glucokinase-based vaccines.

  • Cross-protection potential: Given the conservation of glk across Burkholderia species, recombinant glk might offer cross-protection against multiple Burkholderia pathogens, though this requires experimental verification.

  • Safety considerations: Recombinant subunit vaccines offer safety advantages over live attenuated vaccines, which can revert to virulence. Purified r-glk protein eliminates risks associated with whole organism vaccines .

  • Delivery system development:

    • Adjuvant selection for optimal immune response

    • Formulation optimization for stability and immunogenicity

    • Administration route determination

The evidence from related bacterial systems suggests that properly developed recombinant Burkholderia glk vaccines could potentially address challenges associated with current vaccine approaches for Burkholderia infections.

How can site-specific glycosylation patterns in Burkholderia glk be characterized and manipulated for research purposes?

Characterizing and manipulating site-specific glycosylation of Burkholderia glk requires specialized approaches:

  • Glycosylation site mapping:

    • Multi-protease glycoproteomic approaches enable high-confidence glycoproteome determination

    • Mass spectrometry analysis with higher-energy collisional dissociation (HCD) and electron transfer dissociation (ETD) fragments both peptide backbone and glycan portions

    • Data analysis using specialized software such as O-Pair significantly improves site localization confidence

  • Glycan structure analysis:

    • Combination of enzymatic release, permethylation, and MS/MS analysis

    • Glycan linkage analysis by GC-MS of partially methylated alditol acetates

    • NMR for detailed structural characterization

  • Glycosylation manipulation strategies:

    • Engineering expression hosts with defined glycosylation machinery

    • Site-directed mutagenesis of Serine residues to prevent or redirect glycosylation

    • Introduction of novel glycosylation sites in non-native contexts

  • PglL enzyme engineering:

    • Modification of PglL oligosaccharyltransferases to alter specificity

    • Co-expression systems with engineered glycosylation enzymes

Current research indicates that PglL enzymes in Burkholderia specifically target Serine residues, with glycoproteins and glycosylation sites being highly conserved across strains . This preference should guide experimental design when manipulating glycosylation for research applications.

What experimental approaches can determine the in vivo role of Burkholderia glk in bacterial physiology and virulence?

Determining the in vivo role of Burkholderia glk requires multifaceted experimental approaches:

  • Genetic manipulation strategies:

    • Gene deletion via homologous recombination to create clean knockouts

    • Conditional expression systems using inducible promoters for essential genes

    • Complementation studies to confirm phenotypes

    • Site-directed mutagenesis to create catalytically inactive variants

  • Phenotypic characterization:

    • Growth curve analysis under various nutrient conditions

    • Metabolite profiling using LC-MS/MS to identify altered metabolic pathways

    • Stress response assessment (oxidative, pH, temperature, osmotic)

    • Biofilm formation quantification

    • Motility assays

  • Host interaction studies:

    • In vitro infection models using relevant cell lines

    • Ex vivo tissue models for organ-specific interactions

    • In vivo animal models with appropriate controls:

      • Survival analysis

      • Bacterial burden quantification

      • Histopathological examination

      • Immune response characterization

  • Omics-based approaches:

    • Transcriptomics to identify differentially expressed genes in mutants

    • Proteomics to assess global protein expression changes

    • Metabolomics to map metabolic pathway alterations

  • Structural biology integration:

    • Protein crystallization to determine structure

    • Structure-function relationship studies

    • Protein-protein interaction mapping

Multiple genetic modification techniques have been successfully applied in Burkholderia species, including traditional homologous recombination, Red/ET recombination, Flp-FRT recombination, promoter exchange strategies, and transposon mutagenesis , providing a robust toolkit for these investigations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.