Recombinant Burkholderia sp. Disulfide bond formation protein B 1 (dsbB1)

Shipped with Ice Packs
In Stock

Description

Biological Significance of Disulfide Bonds

Disulfide bonds play a crucial role in protein folding and stability, particularly for proteins that function outside the cytoplasm. These covalent linkages between cysteine residues help maintain the tertiary structure of proteins, which is essential for their proper function. In bacterial systems, the formation of disulfide bonds occurs primarily in the periplasmic space of Gram-negative bacteria, where specialized enzymes catalyze this process. The oxidative environment of the periplasm facilitates disulfide bond formation, allowing secreted proteins and virulence factors to adopt their native conformations .

In bacterial pathogens, proper disulfide bond formation is particularly critical for the maturation of virulence factors including toxins, adhesins, and secretion system components. The inability to form correct disulfide bonds can lead to misfolded proteins that are either inactive or rapidly degraded, significantly impacting bacterial pathogenicity and survival. This makes the disulfide bond formation system an attractive target for antimicrobial development and virulence factor identification .

The DsbA-DsbB System in Gram-Negative Bacteria

The primary machinery responsible for disulfide bond formation in Gram-negative bacteria is the DsbA-DsbB system. DsbA is a periplasmic oxidoreductase that directly introduces disulfide bonds into substrate proteins, while DsbB is a membrane-bound protein that reoxidizes DsbA, allowing it to catalyze multiple rounds of disulfide bond formation. This cycling mechanism ensures the continuous formation of disulfide bonds in newly synthesized periplasmic proteins .

Research on Burkholderia cepacia has demonstrated that the DsbA-DsbB system is essential for multiple physiological functions. Mutations in either dsbA or dsbB genes result in defects in protease production and alkaline phosphatase activity, as well as reduced bacterial motility. These findings underscore the importance of this system in bacterial physiology beyond simple protein folding .

Protein Properties

Commercial recombinant Burkholderia sp. dsbB1 is typically produced with specific modifications to facilitate purification and study. Key properties of the recombinant protein are summarized in the table below:

PropertySpecification
Source SpeciesBurkholderia lata
Expression SystemE. coli
TagN-terminal His
Protein LengthFull Length (1-170 amino acids)
Physical FormLyophilized powder
Purity>90% as determined by SDS-PAGE
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
Optimal Storage-20°C/-80°C, avoid repeated freeze-thaw cycles

These properties are important considerations for researchers utilizing recombinant dsbB1 in experimental settings, as they affect protein stability, activity, and experimental applications .

Expression Systems

The production of recombinant Burkholderia sp. dsbB1 typically utilizes E. coli as the heterologous expression host. This approach allows for high-yield production of the target protein while maintaining its structural and functional properties. The expression of membrane proteins like dsbB1 presents particular challenges due to potential toxicity and proper membrane insertion requirements. To address these issues, specialized E. coli strains and expression vectors are employed, often featuring regulated promoters that allow controlled induction of protein expression .

The commercially available recombinant dsbB1 protein is produced with an N-terminal histidine tag, which facilitates purification without significantly altering the protein's functional properties. This design choice represents a balance between purification efficiency and maintaining native protein characteristics, allowing researchers to work with a product that closely approximates the natural dsbB1 protein .

Purification Methods

The purification of recombinant dsbB1 typically employs affinity chromatography techniques that exploit the presence of the histidine tag. This approach allows for selective binding of the tagged protein to metal-chelating resins, followed by elution under controlled conditions. The membrane-bound nature of dsbB1 necessitates the use of detergents during the purification process to solubilize the protein and maintain its stability in aqueous solutions .

Following initial affinity purification, additional chromatographic steps may be employed to achieve the high purity (>90%) reported for commercial preparations. The purified protein is then typically processed into a stabilized lyophilized powder form for long-term storage and distribution .

Disulfide Bond Formation Mechanism

The disulfide bond formation mechanism catalyzed by the DsbA-DsbB system involves a series of thiol-disulfide exchange reactions. In this process, dsbB1 plays a critical role in reoxidizing DsbA after it has transferred its disulfide bond to substrate proteins. The redox-active cysteine residues in dsbB1 form a disulfide bond that is transferred to reduced DsbA, thereby regenerating the oxidized form of DsbA that can participate in another round of substrate oxidation .

This electron transfer cascade ultimately connects to the respiratory chain through quinones, coupling disulfide bond formation to cellular respiration. The efficiency of this system ensures that newly synthesized periplasmic proteins can rapidly form their native disulfide bonds, which is particularly important for virulence factors and other proteins involved in bacterial pathogenesis .

Interaction with DsbA

The functional partnership between dsbB1 and DsbA is essential for efficient disulfide bond formation in the bacterial periplasm. Research on Burkholderia cepacia has shown that DsbA contains a characteristic redox-active site with the sequence Cys-Pro-His-Cys, which is homologous to the well-studied Escherichia coli DsbA. This active site participates in thiol-disulfide exchange reactions with both substrate proteins and dsbB1 .

Interestingly, genomic analyses have revealed that some Burkholderia species, such as B. pseudomallei, possess multiple DsbA and DsbB homologs. This redundancy suggests a potentially more complex disulfide bond formation system that may be specialized for different substrates or conditions. For example, in Pseudomonas aeruginosa, which has a similar arrangement with two dsbA and two dsbB homologs, DsbA1 can be oxidized by both DsbB1 and DsbB2 proteins, indicating functional overlap between the DsbB paralogs .

Impact on Bacterial Physiology

The DsbA-DsbB system, including dsbB1, has profound effects on various aspects of bacterial physiology in Burkholderia species. Studies with dsbB mutants have demonstrated defects in several key phenotypes:

  1. Reduced production of extracellular proteases

  2. Decreased alkaline phosphatase activity

  3. Impaired bacterial motility

  4. Increased sensitivity to heavy metals such as Cd²⁺ and Zn²⁺

  5. Enhanced susceptibility to multiple antibiotics, including β-lactams, kanamycin, erythromycin, novobiocin, ofloxacin, and sodium dodecyl sulfate

These phenotypic changes highlight the broad impact of dsbB1 function on bacterial physiology, extending beyond simple protein folding to influence multiple cellular processes. The connection to antibiotic resistance is particularly noteworthy, as it suggests that the DsbA-DsbB system contributes to the intrinsic antimicrobial resistance that characterizes many Burkholderia species .

Role in Virulence Factor Maturation

The dsbB1 protein plays a critical indirect role in bacterial pathogenesis through its contribution to the maturation of virulence factors. Many secreted virulence determinants in Gram-negative bacteria require disulfide bonds for their proper folding and function. By maintaining DsbA in its oxidized state, dsbB1 ensures the continuous formation of these essential disulfide bonds in virulence-associated proteins .

Research on related pathogens has demonstrated the importance of the DsbA-DsbB system for virulence. In Pseudomonas aeruginosa, for example, the deletion of dsbA1 and the double deletion of dsbB1/dsbB2 cause a decrease in virulence in pneumonia and keratitis mouse models. This finding suggests that inhibitors of disulfide bond-forming enzymes could potentially affect the folding of several virulence factors, providing a rationale for targeting this system in antimicrobial development .

Contribution to Antibiotic Resistance

One of the most significant findings regarding dsbB1 function is its contribution to antibiotic resistance in Burkholderia species. Mutation in the DsbA-DsbB system results in increased sensitivity to various antibiotics, including β-lactams, aminoglycosides, macrolides, and fluoroquinolones. This broad-spectrum reduction in antimicrobial resistance suggests that the disulfide bond formation system may be involved in the proper folding and function of multiple drug efflux systems or other resistance mechanisms .

The clinical relevance of this observation is particularly significant for Burkholderia species, many of which are naturally resistant to multiple antibiotics. Understanding the role of dsbB1 in maintaining this resistance could potentially lead to the development of adjuvant therapies that sensitize these bacteria to conventional antibiotics by interfering with disulfide bond formation .

Involvement in Metal Efflux Systems

The connection between disulfide bond formation and metal resistance provides further evidence of the broad physiological impact of the DsbA-DsbB system beyond its direct role in protein folding. This finding may have implications for understanding bacterial adaptation to different environmental conditions, including those encountered during infection or in contaminated environments .

Tools for Studying Protein Folding

Recombinant dsbB1 serves as a valuable tool for studying the mechanisms of oxidative protein folding. By reconstituting the DsbA-DsbB system in vitro, researchers can investigate the kinetics and specificity of disulfide bond formation in various substrate proteins. This approach has contributed to our understanding of how conformational folding guides disulfide bond formation, as described in studies of model disulfide-containing proteins .

The availability of purified recombinant dsbB1 also facilitates structural studies aimed at elucidating the molecular details of DsbA-DsbB interactions. While the membrane-bound nature of dsbB1 presents challenges for techniques such as X-ray crystallography, advances in membrane protein structural biology are progressively revealing the structural basis of disulfide bond formation systems .

Development of Antimicrobial Targets

The essential role of dsbB1 in bacterial virulence and antibiotic resistance makes it an attractive target for antimicrobial development. Inhibitors of the DsbA-DsbB system could potentially compromise the structural integrity of multiple virulence factors simultaneously, representing a broad-spectrum approach to attenuating bacterial pathogenicity. Furthermore, such inhibitors might sensitize resistant bacteria to conventional antibiotics by interfering with the proper folding of resistance determinants .

Research on related pathogens has demonstrated the feasibility of this approach. For example, a biosensor system has been developed to screen for inhibitors of DsbB proteins in Pseudomonas aeruginosa. This system uses β-galactosidase activity as a reporter for disruptions in disulfide bond formation, allowing high-throughput screening of compound libraries for potential DsbB inhibitors .

Biotechnological Applications

Beyond its relevance to pathogenesis and antimicrobial development, recombinant dsbB1 has potential applications in biotechnology, particularly in the production of disulfide-bonded proteins. The efficient formation of disulfide bonds is often a limiting factor in the heterologous expression of complex proteins for research or therapeutic purposes. Engineered expression systems incorporating components of the DsbA-DsbB machinery could potentially enhance the yield and quality of such proteins .

The controlled formation of disulfide bonds is especially critical for the production of therapeutic proteins, many of which require specific disulfide patterns for their biological activity. Understanding and harnessing the mechanisms employed by systems like dsbB1 could lead to improved production platforms for these valuable biomolecules .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them in your order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquotting the solution. Store at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
The shelf life of our products is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing it accordingly.
Synonyms
dsbB1; Bcep18194_A4133; Disulfide bond formation protein B 1; Disulfide oxidoreductase 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-170
Protein Length
full length protein
Species
Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Target Names
dsbB1
Target Protein Sequence
MNDYTLAIRRERRLLMLLGWVCIALLAGALYLQYVKNEDPCPLCIIQRYFFCAIGIFAFL AAGIRNWRGVWVLELLIAIAAAGGVGTAARHLTIQMNPGFSCGFDTLQPIVDSLPPAQWF PGMFKVAGLCETVYPPIFGILLPGWSLIGFAVILIAVVASLWRHRRKLVG
Uniprot No.

Target Background

Function
This protein is essential for disulfide bond formation in certain periplasmic proteins. It functions by oxidizing the DsbA protein.
Database Links
Protein Families
DsbB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic function of dsbB1 in Burkholderia species?

Disulfide bond formation protein B1 (dsbB1) in Burkholderia species functions as a membrane-bound oxidoreductase that works in conjunction with DsbA to catalyze disulfide bond formation in secreted and membrane-associated proteins. This process is essential for the proper folding and function of numerous virulence factors. The DsbB protein reoxidizes DsbA after each catalytic cycle, allowing DsbA to continue forming disulfide bonds in substrate proteins. Studies with Burkholderia cepacia have demonstrated that DsbB is required for protease production, with dsbB mutants secreting premature and catalytically inactive forms of protease . Additionally, these mutants show reduced motility, suggesting DsbB's importance in multiple virulence-associated phenotypes . The protein is approximately 170 amino acids in length in B. cepacia and contains transmembrane domains that anchor it to the cytoplasmic membrane .

How does the structure of Burkholderia dsbB1 compare to E. coli DsbB?

While direct structural data for Burkholderia dsbB1 is limited in the provided search results, inferences can be made based on its interaction partner DsbA. The crystal structure of B. pseudomallei DsbA (BpsDsbA) at 1.9 Å resolution revealed significant differences from E. coli DsbA (EcDsbA), particularly in the region surrounding the active site disulfide . These structural differences suggest that the interaction between BpsDsbA and BpsDsbB likely differs from the well-characterized EcDsbA-EcDsbB interaction . Burkholderia dsbB1 likely contains four transmembrane domains with two periplasmic loops containing conserved cysteine residues that are essential for function. The protein is expected to have redox-active disulfide bonds that facilitate electron transfer from DsbA to the respiratory chain. The structural differences in the DsbA-DsbB interface between Burkholderia and E. coli systems may reflect adaptations to specific substrate requirements in these different bacterial species.

What expression systems are most effective for recombinant production of Burkholderia dsbB1?

For recombinant production of membrane proteins like Burkholderia dsbB1, E. coli-based expression systems remain the most widely used approach, though with important modifications to accommodate membrane protein expression. The most effective systems typically employ:

  • E. coli strains optimized for membrane protein expression (C41(DE3), C43(DE3), or Lemo21(DE3))

  • Tightly regulated promoters (such as pBAD or trc) to prevent toxicity from overexpression

  • Fusion partners that enhance folding and membrane integration (such as GFP, MBP, or SUMO)

  • Growth at lower temperatures (16-25°C) after induction to slow protein production and facilitate proper folding

A methodological improvement for expressing Burkholderia membrane proteins involves using specialized detergents during extraction and purification. DDM (n-Dodecyl β-D-maltoside) and LMNG (Lauryl Maltose Neopentyl Glycol) have shown superior results in maintaining protein stability and function. Co-expression with its partner protein DsbA may also enhance stability during purification. When troubleshooting expression, systematic variation of induction conditions (IPTG concentration, temperature, and duration) is essential for optimizing yield and quality of the recombinant protein.

What are the established methods for measuring dsbB1 activity in vitro?

Several robust methods exist for measuring dsbB1 activity in vitro, each providing different insights into protein function:

  • Ubiquinone reduction assay: This spectrophotometric method measures the rate of ubiquinone reduction by dsbB1 during the reoxidation of DsbA. The decrease in absorbance at 275 nm correlates with ubiquinone reduction, providing a direct measure of electron transfer activity.

  • Insulin reduction assay: An indirect measure of the DsbA-DsbB system, where reduced insulin precipitates due to disulfide bond breakage, resulting in increased turbidity at 650 nm. In a coupled system, this assay can assess how efficiently dsbB1 reoxidizes DsbA.

  • Fluorescent peptide assays: Using synthetic peptides with fluorescent tags that change emission properties upon disulfide formation, the kinetics of the reaction can be monitored in real-time.

  • Protein refolding assays: Measuring the rate of refolding of disulfide-containing proteins like RNase A in the presence of the DsbA-DsbB system.

When performing these assays, precise control of buffer conditions is critical, as pH, ionic strength, and temperature significantly affect dsbB1 activity. Additionally, incorporating appropriate detergents at concentrations above their critical micelle concentration is essential for maintaining the native structure of this membrane protein during in vitro assays.

How can I genetically manipulate dsbB1 in Burkholderia species?

Genetic manipulation of dsbB1 in Burkholderia species requires specialized approaches due to the inherent antibiotic resistance and genetic recalcitrance of these bacteria:

  • Allelic exchange systems: The most reliable method involves constructing suicide vectors containing the modified dsbB1 gene flanked by homologous regions. For Burkholderia species, pEX18 or pJQ200 derivatives with appropriate antibiotic resistance markers (trimethoprim or zeocin) have proven effective. The process typically requires two homologous recombination events, which can be selected using counterselectable markers like sacB.

  • CRISPR-Cas9 approaches: More recent protocols have adapted CRISPR-Cas9 for use in Burkholderia, allowing precise genome editing without antibiotic resistance markers. This approach typically uses a dual-plasmid system with one plasmid expressing Cas9 and the other carrying the guide RNA and repair template.

  • Complementation strategies: For studying dsbB1 function, expression from a neutral site in the chromosome often produces more physiologically relevant results than plasmid-based expression.

When constructing dsbB1 mutants, confirmation should include both genomic PCR, sequencing and Southern hybridization as demonstrated in studies with similar genes . For phenotypic validation, assessing protease production using casein plates and motility on soft agar media provides functional confirmation of dsbB1 disruption, as these phenotypes are clearly affected in dsbB mutants .

What proteomic approaches best identify DsbB1-dependent proteins in Burkholderia?

To comprehensively identify DsbB1-dependent proteins in Burkholderia species, several complementary proteomic approaches can be employed:

  • Comparative secretome analysis: Comparing the extracellular proteome of wild-type and dsbB1 mutant strains using liquid chromatography-tandem mass spectrometry (LC-MS/MS) will identify secreted proteins whose processing depends on DsbB1 activity. This approach has successfully identified that dsbB mutants secrete premature and catalytically inactive forms of proteases .

  • Redox proteomics: This specialized approach uses differential alkylation of free thiols followed by mass spectrometry to identify proteins with altered disulfide bonding patterns in dsbB1 mutants compared to wild-type.

  • Pulse-chase experiments: Radiolabeling newly synthesized proteins followed by immunoprecipitation can track the maturation and secretion of specific virulence factors suspected to depend on DsbB1.

  • Diagonal electrophoresis: This two-dimensional technique separates proteins based on their disulfide bonding status, enabling identification of proteins with altered disulfide patterns in dsbB1 mutants.

When analyzing proteomic data, special attention should be paid to virulence factors, particularly proteases and components of secretion systems. Various studies have demonstrated that dsbB mutants in Burkholderia cepacia fail to produce active protease while maintaining lipase activity, suggesting substrate specificity in DsbB-dependent folding pathways . This differential pattern provides important clues about which proteins are most dependent on the DsbB system for proper folding and function.

How does dsbB1 contribute to Burkholderia virulence in infection models?

The contribution of dsbB1 to Burkholderia virulence can be inferred from studies on the DsbA-DsbB system. In B. pseudomallei, a dsbA deletion strain showed significant attenuation in both macrophage infection models and BALB/c mouse models . Given that DsbB is required to maintain DsbA in its active, oxidized form, disruption of dsbB1 would likely produce similar attenuation phenotypes.

The mechanisms by which dsbB1 contributes to virulence are multifaceted:

  • Protease maturation: dsbB1 is essential for the production of catalytically active metalloproteases, as evidenced in B. cepacia where dsbB mutants secrete premature, inactive forms of protease . These proteases are important virulence factors that degrade host tissues and immune components.

  • Motility systems: dsbB mutants show reduced motility , likely due to improper folding of flagellar components that contain disulfide bonds.

  • Secretion system function: The proper folding of components of type II, III, and VI secretion systems often depends on disulfide bond formation, thus likely requiring DsbB1 function.

  • Adhesin maturation: Many bacterial adhesins contain disulfide bonds essential for their structure and function.

In macrophage infection assays, disruption of the Dsb system does not typically affect initial uptake of bacteria but significantly reduces intracellular survival and replication over time . This pattern suggests that DsbB1-dependent proteins are particularly important for intracellular stages of infection, possibly including resistance to oxidative stress and intracellular trafficking.

What is the relationship between dsbB1 and antibiotic resistance in Burkholderia species?

While direct evidence from the provided search results doesn't specifically address the relationship between dsbB1 and antibiotic resistance, several mechanistic connections can be inferred based on the role of disulfide bond formation in bacterial physiology.

The DsbA-DsbB system likely contributes to antibiotic resistance in Burkholderia species through multiple mechanisms:

Given that B. pseudomallei has intrinsic resistance to multiple antibiotics , and that DsbA disruption causes pleiotropic effects on virulence factor production and bacterial fitness, it is reasonable to hypothesize that dsbB1 disruption might alter antibiotic susceptibility profiles. This represents an important area for future research, particularly in the context of developing novel antimicrobial strategies targeting DsbB1.

How do dsbB mutations affect secretion system function across different Burkholderia species?

Mutations in dsbB have profound effects on secretion system function in Burkholderia species, though these effects can vary depending on the specific secretion system and bacterial species. Based on the available evidence:

  • Type II Secretion System (T2SS): This system is particularly affected by dsbB mutations as demonstrated by the inability of B. cepacia dsbB mutants to secrete active protease . The T2SS exports proteins from the periplasm to the extracellular environment, and many of its substrates contain disulfide bonds essential for their structure and function.

  • Flagellar secretion system: The observed motility defects in dsbB mutants suggest impairment in flagellar assembly, which depends on a specialized secretion system for export of flagellar components.

The impact of dsbB mutations on other secretion systems (T3SS, T6SS) in Burkholderia has not been directly addressed in the provided search results, but can be inferred from studies in related systems:

Secretion SystemObserved Effect in dsbB MutantsLikely Mechanism
T2SSSecretion of inactive protease formsImproper folding of protease substrates and possibly T2SS components
FlagellarReduced motilityDefective assembly of flagellar components requiring disulfide bonds
T3SSPredicted impairment (based on related systems)T3SS needle complex proteins often contain disulfide bonds
T6SSPotential effects on assemblySome T6SS components may require disulfide bond formation

Comparative studies between Burkholderia species suggest some consistency in the requirement for disulfide bond formation in secretion system function, but species-specific differences likely exist. In particular, the structural differences noted between B. pseudomallei and E. coli DsbA suggest that the exact mechanism of disulfide bond formation and its impact on secretion may vary across bacterial species, potentially reflecting adaptation to different ecological niches and pathogenic lifestyles.

How can structural information about dsbB1 be used to design specific inhibitors?

Developing specific inhibitors against Burkholderia dsbB1 represents a promising therapeutic strategy, given its importance in virulence and the differences between bacterial and human disulfide bond formation systems. While the search results don't provide specific structural data for Burkholderia dsbB1, information about the related DsbA protein and knowledge of the E. coli DsbB structure can guide inhibitor design:

  • Targeting the DsbA-DsbB interface: Structural differences observed in the active site region of BpsDsbA compared to EcDsbA suggest that the BpsDsbA-BpsDsbB interaction may be distinct . These differences could be exploited to design inhibitors that specifically disrupt this interaction in Burkholderia without affecting human proteins.

  • Quinone binding site inhibitors: DsbB proteins interact with ubiquinone to reoxidize their cysteine residues. Small molecules that compete with ubiquinone for binding to dsbB1 could inhibit its function.

  • Cysteine-reactive compounds: Compounds that selectively react with the catalytic cysteines in dsbB1 would block the electron transfer pathway essential for disulfide bond formation.

  • Transmembrane domain disruptors: Peptides or small molecules that interfere with the assembly or stability of the transmembrane domains unique to dsbB1 could selectively target this protein.

The development pipeline for dsbB1 inhibitors should include:

  • In silico screening based on homology models of Burkholderia dsbB1

  • Biochemical assays to confirm target engagement using purified recombinant dsbB1

  • Cellular assays to verify inhibition of disulfide bond formation in Burkholderia

  • Validation in infection models to confirm attenuation of virulence

This structure-based drug design approach has the potential to yield novel antimicrobials specifically targeting Burkholderia species, addressing the need for new therapeutic options against these multidrug-resistant pathogens .

What experimental approaches can resolve contradictions in the literature regarding dsbB1 function?

Several contradictions exist in the literature regarding the precise function and substrate specificity of dsbB1 across different bacterial species. These contradictions can be addressed through systematic experimental approaches:

  • Cross-complementation studies: Expressing dsbB1 from different Burkholderia species in a common genetic background (e.g., E. coli dsbB mutant) can directly test functional conservation. Similarly, expressing E. coli dsbB in Burkholderia dsbB1 mutants would reveal the degree of functional equivalence.

  • Domain swap experiments: Creating chimeric proteins with domains from different species' dsbB proteins can pinpoint regions responsible for species-specific functions.

  • Site-directed mutagenesis: Targeted mutation of conserved versus divergent residues in dsbB1 can identify amino acids critical for general function versus those involved in species-specific activities.

  • Comparative proteomics: Systematic comparison of disulfide-dependent proteomes across multiple Burkholderia species under identical conditions would resolve inconsistencies in reported substrate specificities.

  • Single-cell analyses: Examining the effects of dsbB1 disruption at the single-cell level using reporter systems can address contradictions that may arise from population heterogeneity.

An integrated approach to resolving contradictions would include:

  • Standardizing experimental conditions across studies

  • Using multiple complementary assays to measure dsbB1 function

  • Carefully controlling genetic backgrounds to minimize confounding effects

  • Employing quantitative rather than qualitative measures of phenotypes where possible

These methodological improvements would help resolve existing contradictions and establish a more coherent understanding of dsbB1 function across the Burkholderia genus.

How can we develop high-throughput screening assays for dsbB1 inhibitors?

Developing high-throughput screening (HTS) assays for dsbB1 inhibitors requires careful consideration of the protein's membrane-bound nature and enzymatic mechanism. Several viable approaches include:

  • Fluorescence-based redox assays: Adapting the traditional DsbB activity assay to a fluorescence-based format using fluorogenic substrates that change emission properties upon oxidation/reduction. For example, using fluorescently-labeled peptides containing engineered disulfide bonds that undergo fluorescence quenching when oxidized by the DsbA-DsbB system.

  • FRET-based protein interaction assays: Developing assays based on Förster resonance energy transfer (FRET) between fluorescently-labeled DsbA and DsbB to monitor their interaction, which would be disrupted by effective inhibitors.

  • Cellular reporter systems: Engineering Burkholderia or E. coli strains expressing a reporter protein whose activity depends on DsbB function. For instance, alkaline phosphatase activity requires disulfide bonds and could serve as a convenient readout.

For optimal assay development, consider these technical parameters:

Assay ParameterRecommended SpecificationsRationale
Z'-factor>0.7Ensures statistical robustness for screening campaigns
Signal-to-background ratio>5:1Provides adequate dynamic range
DMSO toleranceUp to 2%Accommodates compound libraries dissolved in DMSO
Miniaturization384 or 1536-well formatEnables true high-throughput capability
StabilitySignal stable for ≥1 hourAllows batch processing

When implementing these assays, counter-screens must be included to eliminate compounds that interfere with the detection system rather than dsbB1 function. Additionally, secondary assays measuring the formation of disulfide bonds in actual protein substrates should be used to confirm hits from the primary screen, reducing false positives. This multi-tiered approach maximizes the likelihood of identifying specific, potent inhibitors of Burkholderia dsbB1 that could serve as leads for novel antimicrobial development.

What are the most promising approaches for using dsbB1 as a therapeutic target?

The critical role of dsbB1 in Burkholderia virulence makes it an attractive therapeutic target, with several promising approaches:

  • Small molecule inhibitors: Developing compounds that specifically inhibit the electron transfer between DsbA and DsbB or between DsbB and quinones. The structural differences between bacterial and human disulfide bond formation systems offer opportunities for selectivity.

  • Peptidomimetics: Designing peptides that mimic the DsbA-interacting region of DsbB to competitively inhibit this essential protein-protein interaction.

  • Covalent inhibitors: Creating compounds that form irreversible bonds with the catalytic cysteines in DsbB, permanently inactivating the protein.

  • Combination therapies: Using DsbB inhibitors to sensitize Burkholderia to existing antibiotics by compromising multiple virulence mechanisms simultaneously.

  • Antivirulence approach: Rather than killing bacteria directly, DsbB inhibitors would render them less virulent by preventing proper folding of virulence factors. This approach might reduce selective pressure for resistance development.

Based on the critical role of the DsbA-DsbB system in virulence, particularly in protease secretion and intracellular survival , targeting dsbB1 could be especially effective for treating chronic Burkholderia infections where traditional antibiotics often fail. The success of this approach would depend on developing compounds with appropriate pharmacokinetic properties to reach the bacterial periplasm where DsbB functions.

How does environmental stress affect dsbB1 expression and function in Burkholderia species?

Environmental stress likely has significant impacts on dsbB1 expression and function in Burkholderia species, though direct evidence is limited in the provided search results. Based on knowledge of redox systems in bacteria, several informed hypotheses can be proposed:

  • Oxidative stress: Exposure to reactive oxygen species (ROS) likely upregulates dsbB1 expression as part of a coordinated response to maintain proper protein folding under oxidizing conditions. The DsbA-DsbB system may work in concert with other oxidative stress response elements.

  • Nutrient limitation: Under nutrient restriction, particularly within host environments, dsbB1 expression may be modulated to prioritize the folding of essential virulence factors required for survival.

  • pH stress: Within acidified phagosomes or in acidic environmental niches, dsbB1 function may be altered due to pH effects on protein interactions and redox potentials.

  • Temperature stress: Temperature fluctuations encountered during host infection or environmental transitions may affect dsbB1 expression and the efficiency of disulfide bond formation.

To systematically investigate these effects, researchers should consider:

  • Using transcriptomics and proteomics to monitor dsbB1 expression under various stress conditions

  • Employing redox-sensitive fluorescent reporters to track disulfide bond formation kinetics in vivo during stress exposure

  • Analyzing the impact of stress conditions on specific DsbB-dependent phenotypes like protease secretion and motility

Understanding how environmental stress affects dsbB1 function would provide valuable insights into Burkholderia adaptation strategies during infection and environmental persistence, potentially revealing new opportunities for therapeutic intervention.

What is the evolutionary significance of differences between dsbB homologs across bacterial species?

The evolutionary significance of differences between dsbB homologs across bacterial species reflects adaptation to diverse ecological niches and pathogenic lifestyles:

  • Substrate specificity adaptation: Variations in dsbB sequence and structure likely evolved to optimize interaction with species-specific substrates. For instance, the unique virulence factors of Burkholderia species may have driven coevolution of their disulfide bond formation machinery. The observed differences between B. pseudomallei and E. coli in the DsbA active site region suggest parallel differences in their DsbB partners.

  • Environmental adaptation: Bacteria inhabiting different environments face varying redox challenges. Burkholderia species are found in diverse environments ranging from soil to the human respiratory tract, potentially requiring adaptations in their disulfide bond formation machinery to function optimally across these contexts.

  • Host-pathogen coevolution: In pathogenic species like B. pseudomallei and B. cepacia, disulfide bond formation is critical for virulence . Differences in dsbB may reflect adaptation to specific host defense mechanisms, particularly oxidative defenses.

  • Redox partner coevolution: Different bacterial species utilize various electron acceptors in their respiratory chains. DsbB must efficiently interact with these species-specific redox partners, potentially driving evolutionary divergence.

Comparative genomic analysis reveals that while core functional domains of dsbB are conserved across species, significant variations exist in regions mediating protein-protein interactions and membrane topology. This pattern of conservation and diversification suggests that bacterial dsbB homologs maintain their fundamental redox function while adapting to species-specific requirements for protein folding and virulence factor production. Understanding these evolutionary patterns could guide the development of species-specific inhibitors targeting unique features of Burkholderia dsbB1.

What are the major challenges in purifying active recombinant dsbB1 and how can they be overcome?

Purifying active recombinant dsbB1 presents several significant challenges due to its nature as an integral membrane protein with multiple transmembrane domains. The major challenges and their solutions include:

  • Protein expression levels:

    • Challenge: Low expression yields are common for membrane proteins.

    • Solution: Optimize codon usage for the expression host; use strong, inducible promoters; explore fusion proteins (MBP, SUMO) to enhance solubility; and test specialized E. coli strains like C41(DE3) designed for membrane protein expression.

  • Membrane extraction:

    • Challenge: Efficiently extracting dsbB1 from membranes without denaturing it.

    • Solution: Screen different detergents systematically; mild detergents like DDM, LMNG, or digitonin often preserve activity. Consider implementing a detergent exchange step during purification to optimize stability.

  • Maintaining redox state:

    • Challenge: Preserving the native redox state of catalytic cysteines.

    • Solution: Perform purification under controlled redox conditions; include reducing agents during early purification steps followed by controlled oxidation; consider purifying in the presence of its redox partner ubiquinone.

  • Protein stability:

    • Challenge: Rapid loss of activity during purification.

    • Solution: Perform all steps at 4°C; add glycerol (10-20%) to buffers; consider adding lipids (like E. coli polar lipid extract) to stabilize the protein in detergent micelles.

  • Functional assessment:

    • Challenge: Verifying that purified dsbB1 retains activity.

    • Solution: Develop robust activity assays measuring ubiquinone reduction or DsbA reoxidation; include appropriate controls to distinguish specific activity from background.

A comprehensive purification strategy might employ:

  • IMAC (immobilized metal affinity chromatography) for initial capture

  • Size exclusion chromatography to remove aggregates and detergent micelles

  • Optional ion exchange chromatography for further purification

Each purification step should be validated using both SDS-PAGE and activity assays to monitor protein quality and function. When encountering difficulties, engineering additional stability through strategic mutations or utilizing nanodiscs or amphipols as alternatives to detergents can significantly improve outcomes.

How can contradictory results between in vitro and in vivo studies of dsbB1 function be reconciled?

Contradictory results between in vitro and in vivo studies of dsbB1 function are common due to the complexity of disulfide bond formation within the cellular context. Reconciling these contradictions requires systematic investigation of several factors:

  • Redox environment differences:

    • Contradiction: dsbB1 may show different activities in vitro versus in vivo due to differences in redox potentials.

    • Reconciliation approach: Carefully adjust buffer conditions in vitro to mimic periplasmic redox environments; measure and report redox potentials; use redox buffers to maintain defined conditions.

  • Protein interaction networks:

    • Contradiction: In vitro studies often examine dsbB1 in isolation or only with DsbA, while in vivo it functions within a complex network of redox proteins.

    • Reconciliation approach: Reconstitute more complete systems in vitro by including additional partners like quinones and potentially other periplasmic oxidoreductases; use pulldown assays to identify all relevant interaction partners.

  • Substrate accessibility:

    • Contradiction: In vitro assays may use model substrates that don't accurately represent the natural substrates encountered in vivo.

    • Reconciliation approach: Identify and purify natural substrates from Burkholderia for in vitro assays; develop cellular assays that monitor the oxidation of specific, physiologically relevant proteins.

  • Membrane environment effects:

    • Contradiction: Detergent-solubilized dsbB1 may behave differently than membrane-embedded protein.

    • Reconciliation approach: Use membrane mimetics like nanodiscs or proteoliposomes for in vitro studies; compare results across different membrane mimetic systems.

The most effective approach to reconciling contradictions is to develop a series of increasingly complex experimental systems that bridge the gap between simplified in vitro assays and complex in vivo environments:

Experimental SystemComplexityAdvantagesLimitations
Purified proteins in detergentLowDetailed mechanistic studies possibleFar from native environment
Reconstituted membranesMediumBetter mimics membrane environmentStill lacks cellular context
Permeabilized cellsMedium-highMaintains cellular organizationDifficult to control conditions
Genetic complementationHighMost physiologically relevantChallenging to isolate specific effects

By systematically comparing results across this spectrum of experimental approaches, researchers can identify the specific conditions that lead to contradictory results and develop a more nuanced understanding of dsbB1 function in its native context.

What considerations are important when designing dsbB1 gene knockout and complementation experiments?

Designing rigorous dsbB1 gene knockout and complementation experiments requires careful consideration of several critical factors to ensure valid and reproducible results:

  • Knockout strategy selection:

    • In-frame deletion: Preferable to avoid polar effects on downstream genes, particularly important as dsbB may be part of an operon.

    • Insertion inactivation: If used, should be designed to minimize disruption of adjacent gene expression.

    • Complete gene deletion: Most definitive but may remove regulatory elements affecting other genes.

  • Genetic background considerations:

    • Use multiple Burkholderia strains to ensure findings are not strain-specific.

    • Consider constructing the mutation in both virulent and avirulent backgrounds.

    • Verify growth rates in different media to identify potential secondary mutations.

  • Complementation design:

    • Expression level control: Use native promoters rather than strong constitutive promoters to avoid overexpression artifacts.

    • Integration site: Chromosomal integration at a neutral site is preferable to plasmid-based complementation.

    • Wild-type controls: Include both the parent strain and the complemented mutant in all experiments.

  • Verification requirements:

    • Confirm knockout by PCR, sequencing, and Southern hybridization .

    • Verify protein absence by Western blot if antibodies are available.

    • Confirm complementation restores protein expression to wild-type levels.

  • Phenotypic analysis:

    • Assess multiple phenotypes including protease activity, motility, and virulence in infection models .

    • Include quantitative assays rather than relying solely on qualitative observations.

    • Perform time-course experiments to capture temporal aspects of phenotypes.

  • Controls for spontaneous suppressor mutations:

    • Passage the mutant strain multiple times and recheck phenotypes.

    • Sequence the genome of the mutant to identify potential compensatory mutations.

    • Test multiple independent mutant clones to ensure reproducibility.

By adhering to these design principles, researchers can generate dsbB1 mutants that reliably reflect the true function of this gene and avoid common artifacts that lead to misinterpretation of results. The comprehensive analysis of B. pseudomallei dsbA mutants provides a useful template for how similar studies with dsbB1 should be conducted.

How does current understanding of dsbB1 compare across different Burkholderia species?

Current understanding of dsbB1 varies considerably across different Burkholderia species, with more extensive characterization in some species than others:

  • Burkholderia cepacia:

    • Well-characterized functional role in protease production and motility

    • Detailed genetic studies confirming that dsbB mutants secrete premature, inactive forms of protease

    • Clear linkage established between dsbB and virulence-associated phenotypes

    • Less information available on structural aspects and interaction with DsbA

  • Burkholderia pseudomallei:

    • More limited direct studies on dsbB1, with most information inferred from studies on its partner DsbA

    • Structural studies of DsbA suggest differences in the DsbA-DsbB interface compared to E. coli

    • DsbA contributes significantly to virulence in both macrophage and mouse models

    • The critical role of DsbA in virulence suggests a similarly important role for DsbB1

  • Other Burkholderia species:

    • Limited information available for B. mallei, B. thailandensis, and environmental Burkholderia species

    • Conservation of dsbB sequences suggests functional importance across the genus

    • Species-specific variations may reflect adaptation to different ecological niches

The comparative analysis reveals that while the fundamental role of dsbB1 in disulfide bond formation appears conserved across Burkholderia species, there are likely important species-specific adaptations in substrate specificity and interactions with redox partners. Future research should focus on systematic comparative studies to better understand how variations in dsbB1 structure and function contribute to the diverse lifestyles and virulence strategies of different Burkholderia species.

What are the most critical knowledge gaps that need to be addressed in dsbB1 research?

Despite significant progress in understanding Burkholderia dsbB1, several critical knowledge gaps remain that should be prioritized in future research:

  • Structural characterization: No high-resolution structure of Burkholderia dsbB1 has been published. Determining its structure, particularly in complex with DsbA and/or ubiquinone, would provide crucial insights for drug design efforts and mechanistic understanding.

  • Substrate specificity determinants: The molecular basis for which proteins depend on the DsbB-DsbA system for folding remains poorly defined. Comprehensive identification of DsbB-dependent proteins across different Burkholderia species would reveal patterns of substrate recognition.

  • Regulatory mechanisms: How dsbB1 expression is regulated in response to environmental conditions, stress, and during infection remains largely unknown. Understanding these regulatory networks would reveal potential intervention points.

  • Species-specific functions: While dsbB function has been studied in B. cepacia and can be inferred for B. pseudomallei from DsbA studies , systematic comparison across the Burkholderia genus is lacking.

  • Alternative pathways: The existence and importance of alternative disulfide bond formation pathways that might compensate for dsbB1 deficiency under certain conditions has not been thoroughly explored.

  • Host-pathogen interface: How the DsbB-DsbA system influences specific host-pathogen interactions, particularly in chronic infections, requires further investigation.

  • Therapeutic potential validation: Proof-of-concept studies demonstrating that pharmacological inhibition of dsbB1 attenuates Burkholderia virulence in vivo would validate this target for drug development.

Addressing these knowledge gaps would significantly advance our understanding of dsbB1 biology and accelerate the development of novel therapeutic strategies targeting this system in Burkholderia infections.

How might systems biology approaches enhance our understanding of dsbB1 function in the context of bacterial physiology?

Systems biology approaches offer powerful tools to understand dsbB1 function within the broader context of bacterial physiology, providing insights that traditional reductionist approaches might miss:

A systems biology workflow for studying dsbB1 might include:

  • Generate comprehensive -omics datasets in wild-type and dsbB1 mutant backgrounds

  • Identify significantly altered pathways and processes

  • Construct network models incorporating protein-protein interactions

  • Validate key predictions with targeted experiments

  • Iteratively refine models with new experimental data

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.