Recombinant Burkholderia sp. Disulfide bond formation protein B 2 (dsbB2)

Shipped with Ice Packs
In Stock

Description

Oxidative Protein Folding

  • Mechanism: dsbB2 oxidizes DsbA, enabling DsbA to introduce disulfide bonds into substrate proteins . This process is essential for the stability of virulence factors (e.g., proteases, adhesins) and enzymes involved in antibiotic resistance .

  • Mutant Phenotypes: dsbB2 deletion in Burkholderia cepacia results in:

    • Loss of extracellular protease and alkaline phosphatase activity .

    • Impaired motility and increased sensitivity to Cd²⁺, Zn²⁺, and β-lactams .

Virulence Regulation

  • In Burkholderia pseudomallei, homologs of dsbB2 are required for macrophage invasion and survival in murine models of melioidosis .

Key Studies

  1. Protease Production:

    • B. cepacia dsbB2 mutants secrete inactive protease precursors, highlighting its role in post-translational maturation .

    • Complementation with recombinant dsbB2 restores protease activity and motility .

  2. Antimicrobial Resistance:

    • The DsbA-DsbB2 system stabilizes metal efflux pumps and multidrug resistance proteins, conferring tolerance to heavy metals and antibiotics .

  3. Biotechnological Use:

    • Recombinant dsbB2 is utilized to study oxidative folding mechanisms and engineer disulfide-rich proteins .

Comparative Genomic Insights

  • Conservation: The dsbB2 gene is conserved across Burkholderia species, including B. cepacia, B. pseudomallei, and B. ambifaria, with sequence identities exceeding 88% .

  • Genomic Context: Often co-located with virulence-associated biosynthetic gene clusters (e.g., lipopeptide pathways) .

Challenges and Future Directions

  • Expression Optimization: Heterologous production in E. coli requires codon optimization and membrane protein solubilization strategies .

  • Therapeutic Targeting: Inhibitors of dsbB2 are under investigation to disrupt bacterial virulence without affecting host cells .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize developing it accordingly.
Synonyms
dsbB2; Bcep18194_B3111; Disulfide bond formation protein B 2; Disulfide oxidoreductase 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-168
Protein Length
full length protein
Species
Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Target Names
dsbB2
Target Protein Sequence
MSAPIGATRAERWTLLAIGVASFELVAGALWIQLAWQEDPCPLCIIQRYLFLLIALFTFV AAAGGRRVALLRVLSLTTALAGAAVAVRHIYVQAHPGFSCGFDALQPVIDSLPPAHWLPP VFKVGGLCETLYPPILGLSLPMWALVGFSAIAVALGWRIRAQAVIRTA
Uniprot No.

Target Background

Function
Essential for disulfide bond formation in certain periplasmic proteins. Functions by oxidizing the DsbA protein.
Database Links
Protein Families
DsbB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Disulfide bond formation protein B 2 (dsbB2) and what role does it play in bacterial pathogenesis?

Disulfide bond formation protein B 2 (dsbB2) is a membrane protein that functions within the bacterial disulfide bond (DSB) formation pathway. It forms a functional redox relay with DsbA proteins, enabling the introduction of disulfide bonds in substrate proteins in the bacterial periplasm. This oxidative folding system is essential for the proper folding of many bacterial virulence factors .

In Burkholderia species, dsbB2 is one of two DsbB proteins (alongside dsbB1) that maintain DsbA proteins in their oxidized state, allowing them to continuously catalyze disulfide bond formation in substrate proteins . This system is particularly important for pathogenic bacteria like Burkholderia pseudomallei, where studies have demonstrated that disruption of the DSB system results in attenuated virulence .

How do bacterial disulfide bond formation systems contribute to virulence?

Disulfide bond formation systems are required for the correct folding of numerous secreted virulence factors in pathogenic bacteria. Research with B. pseudomallei has shown that the DSB system is required for virulence in multiple strains tested in animal models .

When the DSB pathway is disrupted, bacteria accumulate proteins with reduced cysteines in their periplasm, as demonstrated by reactions with Ellman's reagent (DTNB) . This disruption affects the folding and function of multiple virulence-associated proteins. For example, in Pseudomonas aeruginosa, studies have identified at least 22 potential substrates of the DSB system, including various secreted enzymes and virulence factors .

The experimental evidence from knockout studies clearly demonstrates that without functional DsbB proteins, pathogenic bacteria show:

  • Reduced secretion of key virulence factors

  • Impaired bacterial growth under certain conditions

  • Attenuated virulence in infection models

How does the dsbB2-DsbA interaction function biochemically?

The interaction between dsbB2 and DsbA forms a critical redox relay that facilitates disulfide bond formation in substrate proteins. This process involves:

  • DsbA proteins donate disulfide bonds to substrate proteins, becoming reduced in the process

  • dsbB2 reoxidizes the reduced DsbA, restoring its catalytic activity

  • dsbB2 transfers electrons to the respiratory chain, typically to quinones

In B. pseudomallei, BpsDsbA has been shown to form a functional redox relay with DsbB proteins. Crystal structures of DsbA-derived peptides complexed with DsbB have provided molecular characterization of this interaction . The interaction involves specific cysteine residues in both proteins that participate in thiol-disulfide exchange reactions.

Studies have demonstrated that DsbB proteins from Burkholderia species can oxidize DsbA with specific kinetic parameters, similar to the well-characterized E. coli system . This redox partnership is essential for continuous disulfide bond formation in the periplasm.

What expression systems are effective for producing recombinant dsbB2?

The most commonly used and effective expression system for recombinant dsbB2 is E. coli. Commercial recombinant Burkholderia sp. dsbB2 is typically expressed as a His-tagged protein in E. coli systems .

When expressing membrane proteins like dsbB2, several considerations are important:

  • Use of specialized E. coli strains that can handle membrane protein expression

  • Temperature optimization (typically lower temperatures around 16-25°C)

  • Induction conditions that prevent toxicity or formation of inclusion bodies

  • Addition of solubilizing agents or detergents during extraction

The recombinant protein is often expressed with tags (such as N-terminal His-tags) to facilitate purification and detection . When designing expression constructs, it's important to consider whether the tag might interfere with protein function or structure.

What purification and storage conditions are optimal for maintaining dsbB2 activity?

The purification of recombinant dsbB2 typically involves:

  • Cell lysis under conditions that preserve membrane protein integrity

  • Solubilization using appropriate detergents

  • Immobilized metal affinity chromatography (IMAC) for His-tagged proteins

  • Size exclusion chromatography for final purification

For storage, the following conditions are recommended based on commercial preparations:

ParameterRecommendation
Storage temperature-20°C to -80°C
Buffer compositionTris/PBS-based buffer, pH 8.0
Stabilizing agents6% Trehalose
ReconstitutionDeionized sterile water (0.1-1.0 mg/mL)
Long-term storageAddition of 5-50% glycerol (final concentration)
Stability considerationsAvoid repeated freeze-thaw cycles

According to product specifications, reconstituted protein should be aliquoted and stored at -20°C/-80°C for long-term storage, while working aliquots can be maintained at 4°C for up to one week .

What experimental methods can be used to assess dsbB2 activity in vitro?

Several biochemical assays can be employed to assess the functional activity of dsbB2:

  • Redox state analysis using AMS: 4-acetamido-4′-maleimidylstilbene-2,2′-disulfonic acid (AMS) covalently reacts with free thiol groups, causing a mobility shift of modified proteins in SDS-PAGE. This can be used to determine whether dsbB2 is capable of maintaining DsbA in an oxidized state .

  • Enzyme kinetics measurements: The rate of DsbA oxidation by dsbB2 can be monitored spectrophotometrically. Studies with related systems have determined the kinetic parameters of the oxidation reaction between DsbA and DsbB proteins .

  • Ellman's reagent (DTNB) assay: This assay can quantitatively measure the accumulation of proteins with reduced cysteines in periplasmic fractions, which would increase in the absence of functional dsbB2 . The table below shows an example of such measurements:

GenotypeA412 reading
Wild type0.081
dsbA101::Tn100.331
dsbB36::Tn100.305

These values demonstrate the accumulation of reduced proteins in both dsbA and dsbB mutants compared to wild-type bacteria .

How can researchers assess the role of dsbB2 in bacterial virulence models?

To evaluate the role of dsbB2 in bacterial virulence, researchers typically use the following approaches:

  • Generation of dsbB2 deletion mutants: Using molecular techniques to create clean deletion mutants of dsbB2 in the pathogen of interest. Studies with B. pseudomallei have generated panels of dsbB deletion strains across different clinical isolates .

  • In vitro virulence assays: These assess hallmarks of virulence such as:

    • Motility assays

    • Protease secretion and activity measurements

    • Resistance to antimicrobial agents

    • Biofilm formation capacity

  • Animal infection models: The most definitive approach involves comparing wild-type and dsbB mutant strains in appropriate animal models of infection. For B. pseudomallei, BALB/c mouse models have demonstrated attenuated virulence of dsbB deletion strains regardless of their in vitro phenotypes .

  • Complementation studies: Reintroducing functional dsbB2, either on plasmids or into the chromosome, to verify that observed phenotypes are specifically due to the absence of dsbB2.

  • Chemical complementation: Studies have shown that adding oxidized DTT (0.2 mM) to growth media can partially restore some phenotypes in dsbB mutants, confirming the role of dsbB in disulfide bond formation .

How can structural information about dsbB2-DsbA interactions inform antimicrobial development?

The structural characterization of DsbB-DsbA interactions provides valuable insights for antimicrobial development strategies:

  • Target interface determination: Crystal structures of DsbA-derived peptides complexed with DsbB proteins reveal specific interaction interfaces that could be targeted by small molecule inhibitors . These structural details help identify "hotspot" residues essential for the interaction.

  • Rational drug design: Understanding the precise molecular interactions enables structure-based drug design approaches targeting either the DsbB protein or the DsbB-DsbA interface. This could lead to compounds that disrupt the redox relay, thereby impairing bacterial virulence.

  • Species-specific targeting: Comparative analysis of DsbB proteins from different bacterial species reveals unique structural features that could enable the development of species-specific inhibitors with reduced broad-spectrum effects.

  • Alternative oxidation pathways: Structural studies also reveal the possibility of oxidized DTT chemically bypassing the need for DsbB in disulfide bond formation , which could inform alternative therapeutic strategies.

The high conservation of dsbB across clinical isolates of B. pseudomallei indicates it is a promising target, as mutations that would confer resistance while maintaining function may be limited .

What mechanisms underlie the differential phenotypes observed in dsbB mutants across bacterial species?

Research has revealed intriguing variations in the phenotypic consequences of dsbB mutations across different bacterial species and even between strains of the same species:

  • Redundancy in redox systems: Some bacteria possess multiple DsbB proteins (such as PaDsbB1 and PaDsbB2 in Pseudomonas aeruginosa) that can partially compensate for each other's functions . In P. aeruginosa, both DsbB proteins can maintain DsbA in an oxidized state in vivo.

  • Strain-specific variations: Studies with B. pseudomallei have demonstrated that dsbB deletion strains from different clinical isolates (K96243, 576, MSHR2511, MSHR0305b, and MSHR5858) show diverse phenotypes in vitro, suggesting strain-specific adaptation or compensation mechanisms .

  • Substrate specificity: Different DsbA proteins may have varying preferences for substrate proteins, affecting which virulence factors are most impacted by dsbB mutations. For example, in P. aeruginosa, 22 potential substrates of the DsbA system have been identified, including various secreted enzymes .

  • Environmental adaptation: The expression and function of dsbB may be influenced by environmental conditions such as pH, temperature, and oxidative stress, leading to context-dependent phenotypes.

Despite these variations in in vitro phenotypes, it's notable that dsbB mutants consistently show attenuated virulence in animal models , confirming the critical role of this protein in pathogenesis.

What technical challenges exist in studying membrane proteins like dsbB2, and how can they be overcome?

Membrane proteins like dsbB2 present several technical challenges for researchers:

  • Expression difficulties:

    • Challenge: Membrane proteins often express poorly or form inclusion bodies in recombinant systems.

    • Solution: Use specialized E. coli strains designed for membrane protein expression, optimize induction conditions (lower temperatures, reduced inducer concentrations), and consider fusion partners that enhance solubility.

  • Purification complexities:

    • Challenge: Maintaining membrane protein stability during extraction and purification.

    • Solution: Screen multiple detergents for optimal solubilization, use gentle purification conditions, and consider amphipols or nanodiscs for stabilization.

  • Functional assay limitations:

    • Challenge: Traditional enzyme assays may not work with membrane-embedded proteins.

    • Solution: Develop specialized assays that monitor electron transfer to quinones or measure the oxidation state of partner proteins like DsbA using AMS-based mobility shift assays .

  • Structural determination barriers:

    • Challenge: Obtaining high-resolution structures of membrane proteins is notoriously difficult.

    • Solution: Use a combination of approaches including crystallization of soluble domains with binding partners, cryo-EM for full-length proteins, and computational modeling based on homologous proteins.

  • In vivo assessment:

    • Challenge: Distinguishing direct effects of dsbB2 mutation from indirect consequences on bacterial physiology.

    • Solution: Use complementation studies, domain-specific mutations, and chemical complementation with oxidized DTT to verify specific roles .

By addressing these challenges with appropriate methodologies, researchers can overcome the inherent difficulties in studying membrane proteins like dsbB2.

How might targeting dsbB2 contribute to novel antimicrobial strategies?

The DSB system presents a promising target for novel antimicrobial development strategies:

Future research should focus on high-throughput screening for small molecule inhibitors of dsbB2 function, structure-based optimization of lead compounds, and validation in relevant infection models.

What is known about the regulation of dsbB2 expression under different environmental conditions?

The regulation of dsbB2 expression remains an area requiring further investigation, but several patterns have emerged from related studies:

Future studies using transcriptomic and proteomic approaches under various environmental conditions would help elucidate the regulatory mechanisms controlling dsbB2 expression and potentially reveal conditions that might sensitize bacteria to DSB system inhibition.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.