Recombinant Burkholderia sp. Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Protein Characterization

Recombinant PlsY from Burkholderia spp. is produced in Escherichia coli with an N-terminal His-tag for purification. Key features include:

PropertyDetails
UniProt IDQ0BCG3 (B. ambifaria), Q39DI4 (Burkholderia sp. strain 383)
Molecular Weight~39–40 kDa (predicted)
Amino Acid Sequence212 residues (e.g., MQILLAALVAYLIGSVSFAVVVSAAMGLADPRS...)
Purity>90% (SDS-PAGE verified)
StorageLyophilized powder at -20°C/-80°C; reconstituted in Tris/PBS buffer
Enzyme ActivityAcylates G3P using acyl-ACP or acyl-CoA substrates

The enzyme’s activity is magnesium-dependent and optimized at neutral pH. Unlike plant GPATs, Burkholderia PlsY lacks bifunctional phosphatase activity, producing LPA instead of monoacylglycerol .

Functional Role in Lipid Biosynthesis

PlsY is essential for bacterial lipid metabolism:

  • Membrane Lipid Synthesis: Generates LPA for phospholipid and glycolipid production .

  • Pathogenicity and Survival: Lipid metabolism in Burkholderia spp. is linked to virulence, biofilm formation, and environmental adaptation .

  • Cepacian Biosynthesis: Indirectly supports exopolysaccharide production (e.g., GDP-D-rhamnose synthesis) via precursor lipid intermediates .

Expression Systems

  • Host: E. coli (BL21 or similar strains) .

  • Yield: High-titer production with His-tag purification (affinity chromatography) .

  • Applications:

    • Biochemical Studies: Substrate specificity and kinetic analyses .

    • Antimicrobial Development: Targeting lipid biosynthesis pathways in pathogenic Burkholderia strains .

    • Biotechnology: Engineering lipid pathways for biofuel or biodegradable polymer production .

Functional Studies

  • Gene Knockouts: plsY deletion in Burkholderia disrupts membrane integrity and reduces survival under stress .

  • Enzyme Kinetics: Limited data exist for PlsY, but related GPATs show K<sub>m</sub> values ~1 mM for G3P .

Potential Research Directions

  1. Mechanistic Studies: Resolve crystal structures to elucidate catalysis and regulation .

  2. Pathogen Targeting: Develop PlsY inhibitors to combat Burkholderia infections in cystic fibrosis patients .

  3. Metabolic Engineering: Optimize PlsY for synthetic biology applications (e.g., lipid-overproducing strains) .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during the production process. If you have a preferred tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
plsY; Bcep18194_A5888; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-212
Protein Length
full length protein
Species
Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Target Names
plsY
Target Protein Sequence
MQILLAALVAYLIGSVSFAVVVSGAMGLADPRSYGSKNPGATNVLRSGNKKAAILTLVGD AFKGWIAVWLARHLGLPDVAVAWVAIAVFLGHLYPVFFRFQGGKGVATAAGVLLAVHPVL GLATALTWLIVAFFFRYSSLAALVAAVFAPVFDVFLFGTGHNPVAWAVLAMSVLLVWRHR GNISKLLAGQESRIGDKKKAAADGGAQDGGKA
Uniprot No.

Target Background

Function
Catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P) to form lysophosphatidic acid (LPA). This enzyme utilizes acyl-phosphate as the fatty acyl donor but does not utilize acyl-CoA or acyl-ACP.
Database Links
Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Glycerol-3-phosphate acyltransferase (plsY) and what is its function?

Glycerol-3-phosphate acyltransferase (plsY) is an enzyme involved in the initial steps of bacterial membrane phospholipid biosynthesis. It catalyzes the transfer of an acyl group from acylphosphate to glycerol-3-phosphate. In the most widely distributed bacterial pathway, PlsX converts acyl-acyl carrier protein to acylphosphate, and then PlsY, as an integral membrane protein, transfers the acyl group from acylphosphate to glycerol-3-phosphate . This reaction is a critical step in phosphatidic acid formation, which serves as a precursor for membrane phospholipid synthesis. The enzyme is essential for bacterial cell membrane formation and integrity, distinguishing it as an important enzyme in bacterial physiology and a potential target for antimicrobial research.

What is the genomic organization of plsY in Burkholderia sp.?

The plsY gene in Burkholderia sp. (strain 383) is designated as Bcep18194_A5888 in the genomic database . This ordered locus name provides information about its position within the bacterial genome. The gene encodes the full-length protein consisting of 212 amino acid residues. Understanding the genomic context of plsY is crucial for comparative genomics studies and for designing gene manipulation experiments that might target this enzyme. The conservation of plsY across bacterial species suggests its evolutionary importance in phospholipid metabolism pathways.

What are the alternative names and classifications for this enzyme?

The enzyme Glycerol-3-phosphate acyltransferase (plsY) from Burkholderia sp. is known by several alternative designations in scientific literature and databases. These include: Acyl-PO4 G3P acyltransferase, Acyl-phosphate--glycerol-3-phosphate acyltransferase, and G3P acyltransferase (abbreviated as GPAT) . The enzyme is classified under EC number 2.3.1.n3 in the Enzyme Commission classification system. It is also sometimes referred to as Lysophosphati(dyl)glycerol-3-phosphate acyltransferase, though this name appears to be truncated in the available information. These multiple nomenclatures reflect the enzyme's function in different biochemical contexts and classification systems, which researchers should be aware of when conducting literature searches.

How does the membrane topology of plsY contribute to its enzymatic function?

The membrane topology of plsY has been studied using the substituted cysteine accessibility method in Streptococcus pneumoniae, which can provide insights into the likely structure of Burkholderia sp. plsY. Research indicates that PlsY contains five membrane-spanning segments with the amino terminus and two short loops located on the external face of the membrane . The enzyme has three larger cytoplasmic domains, each containing a highly conserved sequence motif that is critical for catalysis.

This specific topology positions the catalytic residues appropriately within the cytoplasmic domains to access both the membrane-embedded glycerol-3-phosphate substrate and the acylphosphate donor. The arrangement of transmembrane segments creates a scaffold that maintains the proper orientation of the active site relative to the membrane interface where phospholipid synthesis occurs. This structural organization is essential for the enzyme to perform its function in membrane phospholipid biosynthesis, allowing it to catalyze the acyl transfer reaction while being integrated into the very membrane system it helps to construct.

What are the essential conserved motifs in plsY and their roles in catalysis?

PlsY contains three highly conserved sequence motifs located within its cytoplasmic domains that are critical for catalytic activity. Through site-directed mutagenesis studies, the specific roles of these motifs have been elucidated:

  • Motif 1 contains essential serine and arginine residues that are critical for catalysis . Mutation of these residues significantly impairs enzyme activity, suggesting they may be involved in substrate binding or the catalytic mechanism itself.

  • Motif 2 exhibits characteristics of a phosphate-binding loop . Mutations of the conserved glycines in this motif to alanines result in defects in the binding affinity (Km) for glycerol-3-phosphate. This evidence strongly suggests that Motif 2 corresponds to the glycerol-3-phosphate binding site.

  • Motif 3 contains a conserved histidine and asparagine that are important for activity, as well as a glutamate that is critical for maintaining the structural integrity of PlsY .

These conserved motifs work in concert to position the substrates correctly and facilitate the acyl transfer reaction. Understanding these motifs provides insights into the catalytic mechanism and offers potential targets for the rational design of inhibitors that could have antimicrobial properties.

How do the biochemical properties of Burkholderia sp. plsY compare with plsY from other bacterial species?

While specific comparative data for Burkholderia sp. plsY is limited in the provided search results, insights can be drawn from studies on other bacterial species. The PlsY enzyme from Streptococcus pneumoniae, for example, shares the fundamental catalytic mechanism with other bacterial PlsY enzymes, including those from Burkholderia species .

The membrane topology of five transmembrane segments and the presence of three conserved cytoplasmic motifs appear to be consistent features across bacterial PlsY enzymes . This conservation suggests that the fundamental catalytic mechanism is preserved across bacterial species while allowing for adaptations to specific physiological niches.

What are the optimal storage conditions for recombinant Burkholderia sp. plsY?

For working experiments, it is recommended to prepare small aliquots of the enzyme to minimize freeze-thaw cycles. These working aliquots can be stored at 4°C for up to one week . When handling the enzyme, standard protein handling precautions should be observed, including maintaining a cold chain and avoiding contamination. Proper storage is crucial for maintaining the structural integrity and catalytic activity of the enzyme, especially for kinetic studies and other functional assays where enzyme activity is critical.

What techniques are effective for determining the membrane topology of recombinant plsY?

The substituted cysteine accessibility method (SCAM) has proven effective for determining the membrane topology of PlsY, as demonstrated in studies with Streptococcus pneumoniae PlsY . This technique involves:

  • Introduction of cysteine residues: Systematically introducing cysteine residues at various positions throughout the protein sequence via site-directed mutagenesis.

  • Accessibility assessment: Testing the accessibility of these introduced cysteines to membrane-impermeable sulfhydryl-reactive reagents. Residues exposed to the cytoplasmic side will be accessible to these reagents when applied intracellularly, while those on the external face will be accessible when the reagents are applied extracellularly.

  • Transmembrane segment identification: By mapping the pattern of accessibility, researchers can identify membrane-spanning segments and determine the orientation of loops and termini relative to the membrane.

Additional complementary techniques include:

  • Protease protection assays, where differential susceptibility to proteolytic digestion can reveal exposed versus protected regions

  • Fluorescence spectroscopy with environment-sensitive probes

  • Computational prediction methods based on hydrophobicity analysis and evolutionary conservation

These approaches, particularly when used in combination, can provide a detailed picture of how plsY is arranged within the membrane, which is crucial for understanding its mechanism of action and for structure-based drug design efforts.

What methods are most effective for assessing the enzymatic activity of plsY?

Several methodologies can be employed to effectively assess the enzymatic activity of plsY:

  • Radioisotope-based assays: Using radiolabeled substrates like [14C]-glycerol-3-phosphate or [32P]-acylphosphate to monitor the formation of labeled products. This approach allows for high sensitivity and quantitative measurement of enzyme activity.

  • Coupled enzyme assays: Linking the PlsY reaction to another enzyme reaction that produces a measurable signal, such as changes in absorbance, fluorescence, or luminescence.

  • HPLC or LC-MS analysis: Separating and quantifying the reaction products using chromatographic techniques coupled with appropriate detection methods. This allows for direct measurement of product formation without radiolabeled substrates.

  • Site-directed mutagenesis combined with activity assays: As demonstrated in the research on PlsY, mutating specific residues in the conserved motifs and measuring the resulting changes in enzyme activity can provide insights into the catalytic mechanism .

  • Inhibition studies: Using known inhibitors like palmitoyl-CoA, which has been shown to noncompetitively inhibit PlsY , to characterize the enzyme's regulatory mechanisms and active site properties.

When designing these assays, it's important to consider the membrane-bound nature of the enzyme, which may require the use of detergents or artificial membrane systems to maintain the enzyme in its native conformation.

How can site-directed mutagenesis be applied to study the functional domains of plsY?

Site-directed mutagenesis is a powerful technique for investigating the structure-function relationships of plsY. Based on studies of related enzymes, the following approach can be implemented:

  • Target selection: Identify conserved residues within the three critical motifs of plsY for mutation. For example:

    • In Motif 1: Target the essential serine and arginine residues

    • In Motif 2: Focus on the conserved glycines in the phosphate-binding loop

    • In Motif 3: Select the conserved histidine, asparagine, and glutamate residues

  • Mutation design: Create specific mutations that test hypotheses about residue function:

    • Conservative substitutions (e.g., aspartate to glutamate) to test the importance of side chain length

    • Non-conservative substitutions to completely alter chemical properties

    • Alanine scanning to remove side chain functionality while maintaining backbone structure

  • Expression system: Express the mutant proteins in a suitable system that allows for membrane protein production, such as E. coli with appropriate membrane protein expression vectors.

  • Activity assessment: Compare the kinetic parameters (Km, Vmax, kcat) of wild-type and mutant enzymes to determine how each mutation affects substrate binding and catalysis.

  • Structural integrity verification: Ensure that any observed activity changes are due to specific functional effects rather than gross structural perturbations, possibly using circular dichroism or limited proteolysis.

This approach has successfully revealed that mutations in Motif 2 specifically affect the Km for glycerol-3-phosphate binding, while mutations in Motif 3 can disrupt the structural integrity of the enzyme . Such detailed structure-function analyses provide crucial insights into the catalytic mechanism and can guide the development of specific inhibitors.

How does bacterial plsY differ from eukaryotic glycerol-3-phosphate acyltransferases?

Bacterial plsY and eukaryotic glycerol-3-phosphate acyltransferases (GPATs) exhibit several fundamental differences in their structure, mechanism, and evolutionary origin:

  • Substrate specificity: Bacterial PlsY specifically uses acylphosphate as the acyl donor, derived from acyl-ACP through the action of PlsX . In contrast, eukaryotic GPATs typically use acyl-CoA as the acyl donor.

  • Reaction mechanism: The bacterial PlsY pathway involves a two-step process where PlsX first converts acyl-ACP to acylphosphate, and then PlsY transfers the acyl group to glycerol-3-phosphate . Eukaryotic GPATs perform direct transfer from acyl-CoA to glycerol-3-phosphate.

  • Membrane topology: Bacterial PlsY has a characteristic five transmembrane segment structure , while eukaryotic GPATs have different membrane association patterns depending on the specific enzyme and cellular location.

  • Evolutionary relationship: Bacterial PlsY and eukaryotic GPATs are not homologous and represent an example of convergent evolution, where different protein architectures evolved to catalyze similar reactions.

  • Regulatory mechanisms: The regulation of these enzymes differs significantly between bacteria and eukaryotes, reflecting their different roles in cellular metabolism and adaptation to environmental conditions.

These differences make bacterial PlsY an attractive target for antimicrobial development, as inhibitors could potentially be designed to specifically target the bacterial enzyme without affecting human GPATs.

What are the differences between plsY and plant GPATs with respect to acylation position?

A striking difference between bacterial plsY and certain plant GPATs lies in their acylation position specificity:

  • Position specificity: Bacterial PlsY, including Burkholderia sp. PlsY, catalyzes acylation at the sn-1 position of glycerol-3-phosphate, producing 1-acyl-lysophosphatidic acid (1-acyl-LPA) . In contrast, some plant GPATs, particularly Arabidopsis GPAT4 and GPAT6, have been shown to preferentially esterify acyl groups to the sn-2 position of glycerol-3-phosphate .

  • Bifunctional activity: Interestingly, plant GPAT4 and GPAT6 also possess a phosphatase domain that results in sn-2 monoacylglycerol (2-MAG) rather than LPA as the major product . This bifunctional activity has not been previously described in bacterial PlsY or other organisms.

  • Biological role: The sn-2 specific acylation in plants is associated with cutin biosynthesis, an extracellular polyester on the aerial surface of plants that provides a barrier to pathogens and resistance to stress . This contrasts with the role of bacterial PlsY in membrane phospholipid biosynthesis.

  • Structural basis: The different position specificities are likely due to structural differences in the active sites. In plant GPATs, site-directed mutagenesis has identified specific residues in the phosphatase domain that are critical for this unusual activity .

This fundamental difference in acylation position specificity reflects the divergent evolutionary paths and biological functions of these enzymes in plants versus bacteria.

How do the conserved motifs in Burkholderia sp. plsY compare with those in other bacterial species?

The conserved motifs in plsY enzymes exhibit high levels of sequence conservation across different bacterial species, reflecting their critical roles in enzyme function:

  • Motif 1 contains essential serine and arginine residues that are highly conserved across bacterial species, including Burkholderia and Streptococcus . This conservation suggests a fundamental role in catalysis that has been maintained throughout bacterial evolution.

  • Motif 2 functions as a phosphate-binding loop and contains conserved glycine residues that are critical for glycerol-3-phosphate binding . The conservation of these glycines across bacterial species indicates the universal importance of this structural feature for substrate recognition.

  • Motif 3 with its conserved histidine, asparagine, and glutamate residues is also maintained across diverse bacterial species . The histidine and asparagine are important for catalytic activity, while the glutamate plays a crucial structural role.

What potential exists for using plsY as a target for antimicrobial development?

Glycerol-3-phosphate acyltransferase (plsY) presents several compelling characteristics that make it a promising target for antimicrobial development:

  • Essential bacterial function: PlsY catalyzes a critical step in bacterial membrane phospholipid biosynthesis that is essential for bacterial growth and viability . Inhibiting this enzyme could therefore effectively prevent bacterial proliferation.

  • Absence in humans: The bacterial PlsY pathway, which utilizes acylphosphate as an intermediate, is distinct from the mammalian phospholipid synthesis pathway that uses acyl-CoA directly . This difference minimizes the risk of off-target effects on human metabolism.

  • Conserved across bacteria: The conserved nature of PlsY across diverse bacterial species, including pathogenic ones, suggests that inhibitors could potentially have broad-spectrum activity against multiple bacterial pathogens.

  • Structural information: The elucidation of PlsY's membrane topology and identification of critical catalytic residues provides structural insights that can guide rational drug design approaches .

  • Known inhibition mechanism: The observation that palmitoyl-CoA noncompetitively inhibits PlsY provides a starting point for understanding how the enzyme can be inhibited and for designing more potent and specific inhibitors.

Future research could focus on high-throughput screening of compound libraries against recombinant PlsY, structure-based design of specific inhibitors targeting the conserved motifs, and validation of lead compounds in bacterial growth assays and animal infection models.

How might advanced structural studies enhance our understanding of plsY function?

Advanced structural studies could significantly deepen our understanding of plsY function through several approaches:

  • X-ray crystallography or cryo-electron microscopy: Determining the three-dimensional structure of PlsY at atomic resolution would reveal the precise arrangement of the active site, the orientation of transmembrane helices, and the structural basis for substrate recognition. This information could guide rational drug design efforts and provide insights into the catalytic mechanism.

  • Molecular dynamics simulations: Computational simulations could illuminate how PlsY interacts with the membrane environment, how substrates access the active site, and how conformational changes might occur during catalysis.

  • Hydrogen-deuterium exchange mass spectrometry: This technique could identify regions of PlsY that undergo conformational changes upon substrate binding or during the catalytic cycle.

  • Ligand co-crystallization: Structural studies with bound substrates, products, or inhibitors would reveal the molecular determinants of binding specificity and provide templates for structure-based drug design.

  • NMR studies of domain dynamics: Nuclear magnetic resonance spectroscopy could provide insights into the dynamics of the cytoplasmic domains and how they might move relative to each other during catalysis.

These structural studies would complement the existing biochemical and mutagenesis data to create a comprehensive model of PlsY function at the molecular level. Such insights would not only advance our basic understanding of bacterial phospholipid biosynthesis but could also accelerate the development of new antimicrobials targeting this essential bacterial enzyme.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.