Recombinant Burkholderia sp. Lipid A export ATP-binding/permease protein MsbA (msbA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
msbA; Bcep18194_A5649; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-593
Protein Length
full length protein
Species
Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Target Names
msbA
Target Protein Sequence
METQNTLRKPMDGTGTSPVTVLKRLWPYIRPLIGIVVLAVMTMGVVAATEAGIPALLKPL LDHGFGSHGSDSAKWYVPMAVIGLALVRGVSQYASNYLLNYVSNRILLQLRLEMFQRMLH TGASFFQRETASTVINAIVFEVNQILSVLTGVMVTLVRDSLTVIFLLGYLFYLNWRLTLI VAVILPGIGWLVSKINRRLRRLNREHQTLTNELSYIVEETVGGYKVVKVHNGEAYEMDRF TQMSKRLRGYAMRMTISGGLAQPLTQFLASIALAVVITIAVVQSSNDQTTVGGFVAFVTS MLLVISPLKHLIDVNQPLQRGMTAAELIFGLIDEPAEPQGGGRPLAQSRGDIEFRNVTFD YGAAERPTLDRISFKVAPGEMIALAGPSGSGKTTLVNLLPRFFDPTDGAILVDGVPVADY DLHALRSQMAMVSQDVVLFNDTIAANVAYGQTPDRARVQAALEAANLADAVAAMPDGLDT LVGGNGMRLSGGQRQRLAIARAIYKDAPILILDEATSALDSESERHVQAALERLMEGRTT LVIAHRLSTIERADRILVLEAGKIVEEGSHDELLRHGGLYAHLHRIQYQQQAA
Uniprot No.

Target Background

Function

This protein is involved in lipopolysaccharide (LPS) biosynthesis. It facilitates the translocation of lipid A-core from the inner to the outer leaflet of the inner membrane. The transmembrane domains (TMDs) form a pore in the inner membrane, while the ATP-binding domain (NBD) provides the necessary energy for this process.

Database Links
Protein Families
ABC transporter superfamily, Lipid exporter (TC 3.A.1.106) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of MsbA protein in Burkholderia species and why is it significant for research?

MsbA proteins in Burkholderia species function as essential ABC transporters responsible for flipping lipid A across the inner membrane during lipopolysaccharide (LPS) biosynthesis. This process is critical for outer membrane assembly and bacterial viability. The significance of studying MsbA stems from its essential role in bacterial survival and its contribution to antimicrobial resistance mechanisms in Burkholderia species.

Burkholderia cepacia complex (Bcc) bacteria demonstrate exceptional genetic complexity with three chromosomes and remarkable adaptability to various environmental conditions, including nutrient-depleted settings . The MsbA protein contributes to the maintenance of outer membrane integrity, which is particularly important given that Bcc bacteria exhibit inherent resistance to multiple antibiotics and antiseptics . Research on MsbA helps elucidate mechanisms of membrane biogenesis and potential targets for antimicrobial development against these opportunistic pathogens.

What expression systems are most effective for producing recombinant Burkholderia MsbA protein?

For expression of recombinant Burkholderia MsbA protein, E. coli-based systems often serve as the primary platform due to their efficiency and scalability. Specifically, BL21(DE3) or C41(DE3) strains designed for membrane protein expression yield better results than standard laboratory strains. When working with this membrane-associated protein, consider these methodological approaches:

  • Use vectors with tightly regulated promoters (like pET series with T7 promoter)

  • Incorporate affinity tags that minimally interfere with protein folding and function

  • Optimize expression conditions with lower temperatures (16-20°C) and reduced inducer concentrations

  • Include appropriate detergents (DDM, LDAO) during purification to maintain protein stability

For functional studies, alternative systems such as Pichia pastoris might provide better folding and post-translational modifications. When using these expression systems, codon optimization for the target organism is essential to ensure efficient translation of the Burkholderia-derived sequence.

How should researchers approach the purification of recombinant Burkholderia MsbA protein?

Purification of recombinant Burkholderia MsbA requires specific approaches due to its membrane-embedded nature. A systematic purification protocol should include:

  • Cell lysis using mechanical disruption (French press or sonication) in buffer containing protease inhibitors

  • Membrane fraction isolation through differential centrifugation

  • Solubilization of membrane proteins using appropriate detergents (typically DDM or LDAO at 1-2% concentration)

  • Affinity chromatography utilizing the engineered tag (His-tag purification via IMAC is common)

  • Size-exclusion chromatography to remove aggregates and obtain homogeneous protein

Critical considerations include maintaining cold temperature throughout the process, using stabilizing agents such as glycerol (typically at 10-20%), and including cofactors like ATP or Mg²⁺ in buffers to enhance protein stability. Commercial preparations often use Tris-based buffers with high glycerol content (up to 50%) for storage , which helps maintain protein integrity during freeze-thaw cycles.

How can structural studies of recombinant Burkholderia MsbA inform drug development strategies against Bcc infections?

Structural characterization of Burkholderia MsbA provides crucial insights for rational drug design targeting these resilient pathogens. Researchers should employ multi-technique approaches including:

  • X-ray crystallography of purified MsbA in various conformational states (ATP-bound, nucleotide-free)

  • Cryo-electron microscopy to visualize the protein in a near-native lipid environment

  • Molecular dynamics simulations to understand transition states and substrate interactions

  • NMR studies for dynamic regions not resolved in static structures

The unique evolutionary adaptations in Burkholderia MsbA can be identified through comparative structural analysis with homologs from other pathogens. These structural differences may correlate with the extraordinary resistance profile of Bcc bacteria, which can survive in antiseptic solutions and even metabolize antimicrobials as carbon sources . When designing inhibitors, researchers should target Burkholderia-specific structural features while considering:

Drug development targeting MsbA should account for these factors to create effective antimicrobials against Bcc pathogens that pose significant threats to immunocompromised patients, particularly those with cystic fibrosis .

What are the optimal experimental designs for evaluating the ATPase activity of recombinant Burkholderia MsbA protein?

Robust assessment of Burkholderia MsbA ATPase activity requires carefully designed experiments that account for the protein's membrane association and specific biochemical properties. A comprehensive experimental framework should include:

Table 1: Experimental Design Elements for MsbA ATPase Activity Assays

ParameterRange to TestOptimization Considerations
Detergent typeDDM, LDAO, LMNG (0.01-0.05%)Maintain micelles without inhibiting activity
pH6.5-8.0Test at 0.25 pH unit intervals
Temperature25-37°CMatch physiological conditions
Divalent cationsMg²⁺, Mn²⁺ (1-10 mM)Essential cofactors for ATP hydrolysis
ATP concentration0.1-5 mMDetermine Km and Vmax
Lipid A substrateWith/without lipid AAssess substrate stimulation

For data collection, researchers should employ multiple methodologies:

  • Malachite green phosphate assay for high-throughput screening

  • Coupled-enzyme assays (NADH oxidation) for real-time measurements

  • Radiolabeled ATP hydrolysis for direct quantification

Control experiments must include:

  • Heat-inactivated enzyme controls

  • Well-characterized ATPase inhibitors (vanadate, BeFx)

  • Walker A motif mutants (K to M substitution) to validate ATP-dependence

When interpreting results, consider the adaptability of Burkholderia species to nutrient-limited conditions , which may influence the kinetic properties of their transport proteins compared to homologs from other bacteria.

How can researchers effectively design cross-species comparative studies involving Burkholderia MsbA and its homologs?

Cross-species comparative analysis of MsbA proteins offers valuable evolutionary and functional insights. When designing such studies, researchers should implement a systematic approach:

  • Sequence selection strategy:

    • Include MsbA sequences from diverse Burkholderia species, particularly pathogenic members of the Bcc (B. cenocepacia, B. multivorans)

    • Select homologs from other Gram-negative pathogens (E. coli, P. aeruginosa, Salmonella)

    • Include evolutionary outliers to establish conservation boundaries

  • Experimental standardization:

    • Express all proteins using identical vector backbones and tags

    • Purify under identical conditions to minimize method-induced variations

    • Characterize using consistent assays and equipment

  • Functional comparison parameters:

    • ATPase activity (basal and substrate-stimulated)

    • Lipid A transport efficiency

    • Thermal stability and detergent preference

    • Inhibitor sensitivity profiles

    • Interaction with other membrane components

  • Structural comparison techniques:

    • Hydrogen-deuterium exchange mass spectrometry to identify dynamic regions

    • Limited proteolysis to assess domain boundary differences

    • Crosslinking studies to map conformational variations

When analyzing results, it's crucial to consider the extraordinary metabolic versatility of Burkholderia species and their ability to adapt rapidly through mutation . These characteristics may manifest as functional differences in MsbA compared to homologs from other bacteria, particularly in substrate specificity and regulation mechanisms.

What are the major challenges in obtaining functionally active recombinant Burkholderia MsbA protein and how can they be addressed?

Researchers frequently encounter obstacles when working with recombinant Burkholderia MsbA. The principal challenges and their methodological solutions include:

  • Low expression levels:

    • Implement codon optimization for the expression host

    • Utilize specialized strains (C43, Lemo21) designed for membrane protein expression

    • Test different fusion partners (MBP, SUMO) that enhance solubility

    • Employ controlled expression systems with titratable inducers

  • Protein misfolding and aggregation:

    • Reduce expression temperature to 16-20°C

    • Add chemical chaperones (glycerol, DMSO at low concentrations)

    • Include stabilizing ligands (ATP, ADP) in growth media

    • Screen multiple detergents for optimal extraction

  • Loss of activity during purification:

    • Maintain strict temperature control (4°C throughout)

    • Include substrate or substrate analogs during purification

    • Use lipid nanodiscs or amphipols for detergent-free stabilization

    • Implement on-column refolding strategies for denatured protein

  • Heterogeneity in conformational states:

    • Lock protein in specific conformations using ATP analogs (AMP-PNP, ATP-γ-S)

    • Apply hydrogen-deuterium exchange mass spectrometry to identify flexible regions

    • Utilize thermal shift assays to optimize buffer components

The complex genomic architecture of Burkholderia species (featuring three chromosomes) and their high capacity for adaptation might contribute to unique structural features in their MsbA proteins that require special consideration during recombinant expression and purification.

How should researchers approach validation of recombinant Burkholderia MsbA protein identity and functionality?

Comprehensive validation of recombinant Burkholderia MsbA requires a multi-faceted approach combining analytical techniques with functional assays:

Identity Validation:

  • Mass spectrometry analysis:

    • Peptide mass fingerprinting after tryptic digestion

    • Intact mass determination using ESI-MS

    • Comparison with theoretical mass derived from the Burkholderia sp. sequence (UniProt Q39E73)

  • Immunological validation:

    • Western blotting with antibodies against the protein or affinity tag

    • Epitope mapping to confirm sequence regions

  • N-terminal sequencing:

    • Edman degradation to confirm first 5-10 amino acids

    • Analysis of potential signal peptide cleavage

Functional Validation:

  • ATPase activity assays:

    • Malachite green phosphate detection

    • Demonstration of Mg²⁺-dependence

    • Inhibition by known ABC transporter inhibitors

  • Lipid binding and transport:

    • Fluorescent lipid A analog binding studies

    • Reconstitution in liposomes to measure flipping activity

    • Binding affinity determination via isothermal titration calorimetry

  • Structural integrity:

    • Circular dichroism spectroscopy to verify secondary structure content

    • Thermal shift assays to measure stability

    • Size-exclusion chromatography to assess oligomeric state

When validating recombinant Burkholderia MsbA, researchers should consider the extraordinary adaptability of Bcc bacteria , which might manifest as unique functional characteristics compared to MsbA proteins from other bacterial species, particularly in terms of substrate specificity and environmental stability.

How can recombinant Burkholderia MsbA be utilized in the development of diagnostic tools for Burkholderia infections?

Recombinant Burkholderia MsbA offers potential as a diagnostic biomarker, especially when incorporated into sophisticated detection platforms. Strategic approaches include:

  • Serological diagnostics:

    • Develop ELISA systems using purified recombinant MsbA as capture antigen

    • Validate against serum panels from confirmed Burkholderia infections

    • Assess cross-reactivity with antibodies against related pathogens

    • Determine sensitivity and specificity thresholds

  • Structure-guided epitope selection:

    • Identify Burkholderia-specific surface-exposed epitopes through structural analysis

    • Generate epitope-specific monoclonal antibodies

    • Develop lateral flow immunoassays for point-of-care detection

  • Nucleic acid-based diagnostics:

    • Design PCR primers targeting unique regions of the msbA gene

    • Develop LAMP (Loop-mediated isothermal amplification) assays for field use

    • Create hybridization probes for microarray-based species identification

When developing diagnostic applications, researchers should draw inspiration from successful approaches used with other Burkholderia proteins. For example, the recombinant proteins 0375H and 0375TH from B. mallei demonstrated 100% sensitivity and specificity for glanders diagnosis without cross-reactivity with closely related diseases . Similar principles could be applied to MsbA-based diagnostics, particularly focusing on regions that can differentiate between the 24 closely related species within the Burkholderia cepacia complex .

What are the key considerations for designing inhibitor screening assays targeting Burkholderia MsbA?

Developing effective high-throughput screening (HTS) assays for Burkholderia MsbA inhibitors requires careful consideration of multiple factors:

Table 2: Inhibitor Screening Assay Design Parameters

Assay ParameterRecommended ApproachTechnical Considerations
Primary screening methodATPase activity (phosphate release)Automatable, cost-effective, Z'>0.7
Secondary validationTransport assays in proteoliposomesConfirms functional inhibition
Counter-screeningHuman ABCB1 (P-gp) inhibition assaysEvaluates selectivity
Assay buffersPhosphate-free for Pi detectionAvoid phosphate contamination
Detection technologiesFluorescence, luminescenceMinimize compound interference
Compound librariesNatural products, synthetic collectionsFocus on membrane-permeable compounds
ControlsVanadate, select ABC inhibitorsInclude dose-response curves

Critical methodological considerations include:

  • Assay development:

    • Optimize protein-to-substrate ratios for linear reaction kinetics

    • Ensure DMSO tolerance up to 2% for compound compatibility

    • Validate with known ABC transporter inhibitors at varying concentrations

  • Compound specificity assessment:

    • Test against multiple Burkholderia species MsbA orthologs

    • Compare inhibition profiles against MsbA from non-pathogenic bacteria

    • Evaluate activity against human ABC transporters to assess toxicity potential

  • Structure-activity relationship studies:

    • Implement iterative medicinal chemistry optimization

    • Map binding sites using mutagenesis and structural studies

    • Correlate inhibitor structure with bactericidal activity

This approach should acknowledge the inherent antimicrobial resistance of Burkholderia species , which necessitates innovative inhibitor designs that can overcome efflux mechanisms and penetrate the complex cell envelope of these bacteria.

How can researchers investigate the role of Burkholderia MsbA in antimicrobial resistance mechanisms?

Investigation of MsbA's contribution to Burkholderia's remarkable antimicrobial resistance requires sophisticated experimental approaches:

  • Genetic manipulation studies:

    • Develop conditional knockdown systems for msbA (since direct knockout may be lethal)

    • Create point mutations in conserved motifs to generate hypomorphic alleles

    • Employ CRISPR interference for titratable repression of msbA expression

  • Phenotypic characterization:

    • Determine minimum inhibitory concentrations (MICs) for various antimicrobials under different msbA expression levels

    • Assess membrane integrity using fluorescent dyes (propidium iodide, NPN)

    • Measure LPS production and outer membrane composition changes

  • Biochemical approaches with recombinant protein:

    • Test direct binding of antimicrobials to purified MsbA using biophysical methods

    • Assess competition between lipid A and antimicrobials for transport

    • Determine if antimicrobials serve as transport substrates themselves

  • Structural studies:

    • Obtain co-crystal structures with bound antibiotics

    • Map resistance-conferring mutations onto structural models

    • Compare with MsbA structures from antibiotic-susceptible bacteria

This research is particularly relevant given that Burkholderia cepacia complex bacteria demonstrate inherent resistance to multiple antibiotics and antiseptics and can even use certain antimicrobials as carbon sources . The extraordinary metabolic versatility of these bacteria, coupled with their rapid mutation capability , suggests that MsbA may have evolved unique properties to contribute to their resistance phenotype, possibly through altered substrate specificity or transport efficiency.

How might recombinant Burkholderia MsbA contribute to understanding bacterial adaptation in nutrient-limited environments?

Investigating the role of MsbA in Burkholderia's remarkable environmental adaptability represents a frontier research area. Methodological approaches should include:

  • Comparative expression analysis:

    • Quantify msbA expression levels under standard vs. nutrient-limited conditions

    • Apply RNA-seq to identify co-regulated genes in stress response networks

    • Monitor protein levels and modification states during adaptation

  • Functional characterization under stress:

    • Assess ATPase activity of recombinant MsbA under nutrient limitation mimicking conditions

    • Determine lipid A transport efficiency at different nutrient levels

    • Investigate substrate specificity changes in response to environmental stress

  • Membrane remodeling studies:

    • Analyze lipid A structural modifications during adaptation

    • Characterize MsbA's role in membrane fluidity maintenance

    • Examine interaction with other membrane components during stress

The exceptional ability of Burkholderia species to survive in oligotrophic aquatic environments and metabolize organic matter under nutrient-limited conditions suggests that MsbA may play a pivotal role in membrane adaptation. Particularly relevant is Burkholderia's documented ability to persist in water environments, which poses significant challenges for bacterial survival due to lack of nutrients and low osmolarity . Recombinant MsbA protein studies can elucidate whether this transporter undergoes functional modifications to support membrane integrity under such stressful conditions.

What are the most promising approaches for studying the interaction between Burkholderia MsbA and host immune response factors?

Investigation of MsbA's role in host-pathogen interactions requires sophisticated immunological approaches:

  • Recombinant protein interaction studies:

    • Perform pull-down assays with host immune factors (antimicrobial peptides, complement)

    • Use surface plasmon resonance to quantify binding kinetics

    • Conduct co-immunoprecipitation from infected cell lysates

  • Immunological response characterization:

    • Evaluate TLR4 activation by lipid A transported by wild-type versus mutant MsbA

    • Assess inflammatory cytokine production in response to recombinant MsbA

    • Determine if antibodies against MsbA neutralize bacterial virulence

  • Infection models:

    • Compare wild-type and msbA-modulated strains in cellular infection assays

    • Use conditional expression systems to alter MsbA levels during infection

    • Examine tissue-specific responses in relevant disease models

This research direction is particularly relevant given Burkholderia's significant impact on immunocompromised individuals, especially cystic fibrosis (CF) patients . The CF lung environment presents selective pressures that induce phenotypic and genotypic variations in pathogens , and MsbA may participate in adaptive responses that influence lipid A structure and consequently modulate host immune recognition.

How can systems biology approaches incorporate recombinant Burkholderia MsbA studies to understand cellular networks?

Integration of MsbA research into systems biology frameworks requires multidisciplinary methodologies:

  • Network construction:

    • Map MsbA genetic interactions through synthetic lethality screens

    • Identify protein-protein interactions via proximity labeling approaches

    • Correlate lipidome changes with MsbA expression levels

  • Multi-omics integration:

    • Combine transcriptomics, proteomics, and lipidomics data

    • Develop computational models of membrane biogenesis pathways

    • Simulate effects of MsbA perturbation on cellular networks

  • Comparative systems analysis:

    • Contrast network architecture between Burkholderia and other pathogens

    • Identify unique nodes and edges in Burkholderia membrane transport systems

    • Predict potential compensatory mechanisms during MsbA inhibition

The complex genomic architecture of Burkholderia species, featuring three chromosomes , presents a unique opportunity for systems biology investigations. The capacity for rapid mutation and adaptation exhibited by these bacteria suggests that MsbA functions within a highly responsive network that reconfigures under environmental and host pressures. Understanding these network properties could reveal vulnerabilities in Burkholderia's remarkable resilience and potentially identify novel therapeutic targets.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.