Recombinant Burkholderia sp. Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order and we will fulfill your request.
Lead Time
Delivery time may vary based on the purchase method or location. For precise delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us beforehand. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to concentrate the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which you can use as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us and we will prioritize developing the specified tag.
Synonyms
lspA; Bcep18194_A5845; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-166
Protein Length
full length protein
Species
Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Target Names
lspA
Target Protein Sequence
MAKTLSKPASGALAPWLGISLIVILFDQLSKIAILKTFVYGAQHELTSFFNLVLVYNRGA AFGFLSTAGGWQRWAFTALGIAATLVICFLLKRHGQQRLFSLSLAMILGGALGNVIDRLV YGHVIDFLDFHLGAWHFPAFNLADSAITVGAVLLIYDELRRVRGSR
Uniprot No.

Target Background

Function
This protein specifically catalyzes the removal of signal peptides from prolipoproteins.
Database Links
Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is lipoprotein signal peptidase (lspA) and why is it significant in Burkholderia research?

Lipoprotein signal peptidase (lspA) is an essential enzyme in bacteria, including Burkholderia species, that cleaves the signal peptide from prolipoproteins during their maturation process. The significance of lspA stems from its essential role in bacterial viability, making it an attractive antimicrobial target. In the bacterial lipoprotein processing pathway, lspA functions as the second enzyme, cleaving the signal peptide from lipid-modified prolipoproteins after they have been processed by the first enzyme in the pathway, Lgt (prolipoprotein diacylglyceryl transferase) .

The essentiality of lspA across various bacterial species, including pathogenic Burkholderia, positions it as a critical target for antibiotic development. Natural products such as globomycin have demonstrated inhibitory effects against lspA, providing valuable templates for the development of novel antimicrobials against multidrug-resistant bacteria .

How does lspA function in the lipidation pathway of Burkholderia species?

In Burkholderia species, lspA operates within a defined lipidation pathway that processes bacterial lipoproteins. The pathway begins with Lgt, which transfers a diacylglyceryl group from phospholipids (such as dioleoylphosphatidylglycerol/DOPG) to a cysteine residue in the lipobox motif of the preprolipoprotein. This creates a prolipoprotein (pICP), which becomes the substrate for lspA.

LspA then specifically cleaves the signal peptide from the prolipoprotein, resulting in a diacylated lipoprotein (DA-ICP). This processing step is essential for proper lipoprotein localization and function in the bacterial cell envelope. The activity of lspA can be monitored experimentally through SDS-PAGE gel-shift assays, where the cleavage of the signal peptide results in a measurable molecular weight shift of approximately 10 kDa .

What structural features characterize Burkholderia sp. lspA compared to other bacterial species?

Burkholderia sp. lspA shares core structural features with lipoprotein signal peptidases from other Gram-negative bacteria, while exhibiting distinct characteristics that may influence substrate specificity and inhibitor interactions. While the search results don't provide specific structural details for Burkholderia lspA, these enzymes typically contain multiple transmembrane domains and a catalytic dyad or triad in the active site.

The lipopolysaccharide (LPS) structures of different Burkholderia species, which create the membrane environment where lspA functions, show distinct patterns when analyzed using techniques such as MALDI-TOF MS, revealing species-specific differences in lipid A modifications. Burkholderia lipid A predominantly contains penta-acylated species modified with 4-amino-4-deoxy-arabinose residues at both terminal phosphate groups, with species differentiation possible based on mass differences and fatty acid composition . These membrane characteristics likely influence lspA functionality in its native environment.

What methods are commonly used to express and purify recombinant lspA from Burkholderia species?

Recombinant expression of Burkholderia sp. lspA typically employs specialized systems designed for membrane proteins. While the search results don't detail specific purification protocols for Burkholderia lspA, membrane-bound enzymes like lspA generally require:

  • Expression system selection: E. coli-based systems with appropriate promoters for controlled expression of potentially toxic membrane proteins.

  • Detergent solubilization: Careful selection of detergents to extract lspA from membranes while maintaining enzymatic activity.

  • Purification strategy: Affinity chromatography, often utilizing His-tags or other fusion partners, followed by size exclusion chromatography to achieve high purity.

  • Activity verification: Functional assays such as the SDS-PAGE gel-shift assay to confirm that the purified enzyme maintains catalytic activity. In these assays, substrates like recombinant prepro inhibitor of cysteine protease (ppICP, representing a model preprolipoprotein) are first lipidated by Lgt using dioleoylphosphatidylglycerol (DOPG) as the lipid substrate, then treated with purified lspA. Successful cleavage of the signal peptide can be visualized as an approximately 10 kDa molecular weight shift on SDS-PAGE gels .

How can recombineering systems be optimized for genetic manipulation of lspA in Burkholderia species?

Optimizing recombineering systems for genetic manipulation of lspA in Burkholderia species requires careful consideration of the recombination machinery and protocols. Based on recent research, several approaches have shown promise:

  • Selection of appropriate recombination systems: RecETh TJI49 and RecETh1h2e YI23 demonstrated higher recombination efficiency in Burkholderia glumae PG1 compared to RecEThe BDU8. These systems, derived from different Burkholderia species, exhibit species-specific effectiveness that must be considered when targeting lspA .

  • Optimization of homology arm length: While lambda Red recombination systems in Burkholderia typically require long homology arms (>500 nt), newer RecET-based systems may allow for shorter homology arms, increasing efficiency and ease of construct generation .

  • Enhancement with exonuclease inhibitors: Combining RecET systems with exonuclease inhibitors such as Pluγ or Redγ can significantly improve recombination efficiency. For example, RecET YI23 combined with these inhibitors showed efficiency comparable to Redγβα in E. coli, suggesting potential applicability across Gram-negative bacteria, including various Burkholderia species .

  • Protocol optimization: Factors including transformation method, recovery time, selection strategy, and growth conditions all require species-specific optimization for Burkholderia, which have unique growth requirements compared to model organisms like E. coli.

The table below summarizes relative recombination efficiencies of different systems in Burkholderia glumae PG1:

Recombination SystemRelative Efficiency in B. glumae PG1Notes
RecETh1h2e YI23HighAll components except h2 protein improve recombination
RecETh TJI49HighLow efficiency in E. coli but high in Burkholderia
RecEThe BDU8ModerateFunctional but less efficient than other systems
Redβα7029LowHigh efficiency in S. brevitalea but not in Burkholderia

What are the current challenges in developing specific inhibitors against Burkholderia sp. lspA?

Developing specific inhibitors against Burkholderia sp. lspA faces several significant challenges:

  • Membrane protein targets: LspA is an integral membrane protein, which complicates both structural studies and inhibitor design. The hydrophobic nature of its active site requires inhibitors with specific physicochemical properties to traverse the bacterial membrane.

  • Species-specific variations: While lspA is conserved across bacteria, subtle structural differences exist between species. Computational design of cyclic peptide inhibitors requires detailed structural understanding of the specific Burkholderia lspA variants to achieve selective inhibition .

  • Validation methodologies: Confirming inhibitor activity against lspA requires specialized assays. The SDS-PAGE gel-shift assay has been successfully applied to validate inhibitors, tracking the conversion of lipidated prolipoprotein (pICP) to diacylated lipoprotein (DA-ICP) and measuring inhibition by quantifying signal intensity of the product .

  • Balancing potency and selectivity: Designed inhibitors must strongly inhibit bacterial lspA while avoiding cross-reactivity with host proteases. Recently designed compounds (G2a, G2d, and G1b) have shown promising specific inhibition of lspA, suggesting approaches for further development .

  • Crossing the complex cell envelope: Burkholderia species possess complex cell walls and membranes, characterized by distinct lipopolysaccharide structures that affect permeability. Matrix-assisted laser desorption ionization–time of flight mass spectrometry (MALDI-TOF MS) analysis reveals that Burkholderia lipid A contains predominantly penta-acylated species with specific modifications that differ between species, creating barriers that inhibitors must overcome .

How do mutations in lspA affect lipopolysaccharide structure and immune responses in Burkholderia infections?

The relationship between lspA mutations, lipopolysaccharide (LPS) structure, and immune responses in Burkholderia infections represents a complex interplay of bacterial physiology and host defense. While the search results don't directly address lspA mutations, we can infer several important connections:

  • Lipoprotein processing and LPS biosynthesis: LspA processes numerous lipoproteins, some of which may be involved in LPS biosynthesis or transport. Mutations affecting lspA function could indirectly alter LPS structure by disrupting the maturation of these lipoproteins.

  • Species-specific LPS characteristics: Different Burkholderia species display distinct LPS patterns on SDS-PAGE analysis. B. pseudomallei, B. thailandensis, and B. mallei share similar LPS ladder patterns that differ from other Burkholderia species. These structural differences influence immune recognition and response .

  • Toll-like receptor 4 (TLR4) activation: LPS from all Burkholderia species induces TLR4-dependent NF-κB responses, a critical pathway in innate immunity. Alterations in LPS structure resulting from disrupted lipoprotein processing could potentially modify this immune activation .

  • Cross-reactive antibody responses: Immunoblot analyses demonstrate that patient sera from melioidosis (B. pseudomallei infection) cross-react with O-polysaccharides (OPS) of other Burkholderia species. This has implications for both diagnostics and understanding protective immunity .

  • Potential therapeutic implications: Understanding how lspA mutations affect LPS structure could inform therapeutic approaches targeting both the enzyme and host inflammatory responses to Burkholderia infections.

What role does lspA play in the virulence of Burkholderia species and how can this be experimentally assessed?

LspA plays multifaceted roles in Burkholderia virulence, affecting various pathogenicity mechanisms:

  • Essential enzyme for viability: As the second enzyme in the bacterial lipoprotein processing pathway, lspA is essential for bacterial viability, making it a potential target for antimicrobial development .

  • Processing of virulence factors: Many bacterial virulence factors are lipoproteins that require processing by lspA for proper localization and function. These may include adhesins, toxins, and immune evasion factors.

  • Membrane integrity maintenance: Properly processed lipoproteins contribute to membrane stability and function, which is critical for surviving host defense mechanisms.

Experimental approaches to assess lspA's role in virulence include:

  • Conditional knockdown systems: Since lspA is essential, conditional expression systems or partial inhibition approaches are necessary to study its role in virulence.

  • Inhibitor studies: Compounds like G2a and G2d that specifically inhibit LspA can be used to assess the effect of lspA inhibition on virulence in both in vitro and in vivo models .

  • Virulence factor processing analysis: SDS-PAGE gel-shift assays can track the processing of specific virulence-associated lipoproteins in the presence of wild-type versus inhibited lspA .

  • Animal infection models: Comparing infection outcomes with normal versus inhibited lspA function can reveal its contribution to virulence in vivo.

  • Immune response characterization: Methods such as TLR4 stimulation assays and immunoblot analysis can help understand how lspA-dependent lipoprotein processing affects host immune recognition and response .

What are the optimal protocols for assessing lspA activity in Burkholderia species?

The optimal assessment of lspA activity in Burkholderia species requires specialized approaches targeting this membrane-bound enzyme:

  • SDS-PAGE gel-shift assay: This represents a gold standard for lspA activity assessment. The protocol involves:

    • Expression of a model substrate (e.g., recombinant prepro inhibitor of cysteine protease, ppICP)

    • Conversion of ppICP to pICP by Lgt using dioleoylphosphatidylglycerol (DOPG) as lipid substrate

    • Treatment with lspA to cleave the signal peptide

    • Visualization of the ~10 kDa molecular weight shift by SDS-PAGE

    • Quantification of inhibition by measuring signal intensity of the product diacylated ICP (DA-ICP)

  • Fluorogenic substrate assays: While not explicitly mentioned in the search results, fluorogenic peptide substrates designed to mimic the lipoprotein signal peptide cleavage site can provide quantitative, real-time measurement of lspA activity.

  • Mass spectrometry analysis: Liquid chromatography-mass spectrometry (LC-MS) approaches can precisely identify the cleavage products and sites, providing detailed insights into lspA specificity across different Burkholderia species.

  • Recombinant expression systems: For in-depth characterization, recombinant expression of Burkholderia lspA using systems like RecETh TJI49 and RecETh1h2e YI23, which show high recombination efficiency in Burkholderia, can facilitate site-directed mutagenesis and functional studies .

How can recombinant Burkholderia lspA be used to screen for novel antimicrobial compounds?

Recombinant Burkholderia lspA offers a powerful platform for screening novel antimicrobial compounds through several strategic approaches:

  • High-throughput biochemical assays: Purified recombinant lspA can be used in enzyme activity assays with fluorogenic or chromogenic substrates to rapidly screen compound libraries for inhibitory activity.

  • SDS-PAGE gel-shift screening: This approach has successfully identified specific lspA inhibitors like G2a and G2d. The assay measures inhibition of lspA-mediated cleavage of lipidated prolipoprotein (pICP) to diacylated lipoprotein (DA-ICP), with inhibition quantified by measuring signal intensity of the product .

  • Computational design and screening: Computational approaches have enabled the design of cyclic peptide inhibitors of lspA. These methods can be adapted to target specific structural features of Burkholderia lspA, potentially leading to more selective inhibitors .

  • Whole-cell screening with target validation: Compounds identified through biochemical screens can be further evaluated in whole-cell assays against Burkholderia species. Target validation can confirm that growth inhibition correlates with lspA inhibition.

  • Structure-activity relationship studies: Once hit compounds are identified, structure-activity relationship studies can guide optimization for improved potency, selectivity, and pharmacokinetic properties.

The table below summarizes key compounds identified through lspA inhibitor screening:

CompoundTypeActivityValidation MethodReference
G2aDesigned cyclic peptideSpecific lspA inhibitorSDS-PAGE gel-shift assay
G2dDesigned cyclic peptideSpecific lspA inhibitorSDS-PAGE gel-shift assay
G1bFirst-generation compoundlspA inhibitorGrowth inhibition of reference and multi-drug-resistant bacteria
GlobomycinNatural productlspA inhibitorReferenced as benchmark

What genetic engineering approaches are most effective for modifying lspA in Burkholderia species?

Genetic engineering of lspA in Burkholderia species presents unique challenges due to the gene's essentiality and the innate resistance of Burkholderia to genetic manipulation. Several effective approaches have emerged:

  • Optimized recombineering systems: The RecETh TJI49 and RecETh1h2e YI23 systems have demonstrated high recombination efficiency in Burkholderia glumae PG1. These systems, derived from Burkholderia species, outperform both the RecEThe BDU8 system and the Redβα7029 system (which works well in Shewanella brevitalea but shows low efficiency in Burkholderia) .

  • Enhancement with exonuclease inhibitors: Combining RecET systems with exonuclease inhibitors such as Pluγ or Redγ significantly improves recombination efficiency. The RecET YI23 system combined with these inhibitors shows comparable efficiency to Redγβα in E. coli, suggesting broader applicability across Gram-negative bacteria .

  • In situ promoter insertion: Recombinase-assisted in situ insertion of promoters has successfully activated cryptic biosynthetic gene clusters in Burkholderia strains. This technique could be adapted for controlled expression of modified lspA variants .

  • Conditional expression systems: Since lspA is essential, conditional expression systems (e.g., inducible promoters) are necessary for studying loss-of-function phenotypes.

  • Protein fusion strategies: Tagging lspA with reporters or affinity tags enables purification and localization studies while maintaining its essential function.

Notably, the long homology arms (>500 nt) required by traditional lambda Red recombination systems in Burkholderia and their low recombination efficiency have limited widespread application. The newer RecET-based systems address these limitations, enhancing the feasibility of precise genetic manipulations in Burkholderia species .

What are the best approaches for analyzing the interaction between lspA inhibitors and Burkholderia membranes?

Analyzing interactions between lspA inhibitors and Burkholderia membranes requires specialized techniques that address the complex membrane environment where this enzyme functions:

How can differences in lspA function across Burkholderia species be leveraged for species-specific diagnostics?

Differences in lspA function and its processed lipoproteins across Burkholderia species offer promising avenues for species-specific diagnostics:

  • Species-specific lipoprotein profiles: Since lspA processes numerous lipoproteins, each Burkholderia species likely possesses a unique lipoprotein profile. Mass spectrometry analysis of these profiles could enable species identification and differentiation.

  • Lipopolysaccharide pattern recognition: SDS-PAGE analysis reveals distinct LPS ladder patterns among Burkholderia species, with B. pseudomallei, B. thailandensis, and B. mallei sharing similar patterns that differ from other species. These patterns, influenced by properly processed lipoproteins, can inform diagnostic approaches .

  • Immunological cross-reactivity exploitation: Immunoblot analyses show that melioidosis patient sera cross-react with O-polysaccharides (OPS) of various Burkholderia species. Understanding these cross-reactions can inform serological diagnostics while recognizing potential false positives .

  • Mass spectrometric fingerprinting: MALDI-TOF MS profiles of Burkholderia lipid A demonstrate species-specific mass differences at m/z 1,511, 1,642, 1,773, and 1,926, along with distinctive fatty acid compositions. These differences can be diagnostically valuable .

  • TLR4 activation patterns: While LPSs from all Burkholderia species induce TLR4-dependent NF-κB responses, the magnitude and kinetics may vary in ways that could be diagnostically useful .

The table below summarizes diagnostic approaches leveraging lspA-related differences:

Diagnostic ApproachBasisPotential ApplicationsLimitations
Lipoprotein profilingSpecies-specific patterns of lspA-processed lipoproteinsLaboratory-based species identificationRequires sophisticated equipment
LPS pattern analysisDistinctive SDS-PAGE ladder patternsRapid species groupingCannot always distinguish closely related species
Serological cross-reactivityAntibody recognition of OPSField-deployable diagnostic testsPotential false positives due to cross-reactivity
MALDI-TOF MSSpecies-specific mass differences in lipid APrecise laboratory identificationRequires specialized equipment and training

What are the implications of lspA inhibition for combating multidrug-resistant Burkholderia infections?

Inhibition of lspA presents a promising strategy for addressing multidrug-resistant Burkholderia infections through several mechanisms:

  • Novel target outside existing resistance mechanisms: As lspA functions through a mechanism distinct from conventional antibiotics, inhibitors targeting this enzyme may circumvent existing resistance mechanisms in multidrug-resistant Burkholderia strains.

  • Essential enzyme targeting: LspA is essential for bacterial viability as the second enzyme in the bacterial lipoprotein processing pathway. Inhibition by natural products like globomycin confirms its potential as an antimicrobial target .

  • Demonstrated inhibitor efficacy: Specific inhibitors such as G2a, G2d, and the first-generation compound G1b have demonstrated the ability to inhibit lspA activity and bacterial growth, including against multi-drug-resistant isolates .

  • Validation through multiple approaches: The inhibitory activity of designed compounds has been confirmed through both in vitro enzymatic assays (SDS-PAGE gel-shift assay) and growth inhibition studies against reference and multi-drug-resistant bacteria .

  • Structural diversity potential: The computational design of cyclic peptide inhibitors suggests the possibility of generating diverse structural variants to address species-specific differences and resistance mechanisms .

  • Combination therapy opportunities: LspA inhibitors could potentially be used in combination with existing antibiotics to enhance efficacy or restore sensitivity in resistant isolates.

The development of lspA inhibitors against Burkholderia would address a critical need, as Burkholderia pseudomallei alone is estimated to cause 165,000 cases of melioidosis with approximately 89,000 deaths per year globally . B. pseudomallei and B. mallei are classified as Tier 1 select agents due to their potential use in biological terrorism, further emphasizing the importance of novel treatment strategies .

How can recombinant lspA expression systems be optimized for structural studies and drug development?

Optimizing recombinant lspA expression systems for structural studies and drug development requires addressing several technical challenges inherent to membrane proteins:

  • Expression system selection: For Burkholderia lspA, specialized expression systems that accommodate membrane proteins are essential. The highly efficient RecETh TJI49 and RecETh1h2e YI23 recombineering systems have shown superior performance in Burkholderia species and could be adapted for controlled expression .

  • Construct design considerations:

    • Fusion tags: Strategic placement of purification tags (His, FLAG, etc.) away from functional domains

    • Solubility enhancers: Fusion partners like MBP or SUMO that improve solubility while maintaining function

    • Crystallization aids: T4 lysozyme or thermostabilized domains that facilitate crystal packing

  • Membrane mimetic selection: Detergent screening is critical for extracting active lspA from membranes. Options include:

    • Mild detergents (DDM, LMNG) for initial extraction

    • Amphipols or nanodiscs for long-term stability

    • Lipid cubic phase for crystallization trials

  • Activity verification methods: The SDS-PAGE gel-shift assay provides a functional readout to ensure that purified lspA retains activity. This assay tracks the conversion of lipidated prolipoprotein (pICP) to diacylated lipoprotein (DA-ICP) through a ~10 kDa molecular weight shift .

  • Structural biology approaches:

    • X-ray crystallography: Requires highly pure, homogeneous, and stable protein preparations

    • Cryo-EM: Increasingly viable for membrane proteins, requiring less protein and accommodating heterogeneity

    • NMR: For dynamic studies of smaller domains or ligand interactions

  • Stabilization strategies:

    • Ligand co-purification: Including inhibitors like G2a or G2d during purification to stabilize specific conformations

    • Thermostabilizing mutations: Identified through alanine scanning or computational prediction

    • Lipid supplementation: Maintaining native-like environment with specific lipids found in Burkholderia membranes

The optimization of expression systems specifically for Burkholderia proteins is particularly important given that recombination operons from Burkholderia (especially RecETh TJI49) showed very low efficiency in E. coli but high efficiency in their native context .

What are the most promising directions for lspA research in Burkholderia species?

Research on lspA in Burkholderia species presents several promising directions with significant potential impact:

  • Inhibitor development: The successful computational design of cyclic peptide inhibitors (G2a, G2d) specifically targeting lspA demonstrates the feasibility of developing novel antimicrobials against this essential enzyme . Further optimization of these compounds could lead to clinically viable treatments for Burkholderia infections, including melioidosis and glanders.

  • Genetic engineering platforms: The development of efficient recombineering systems (RecETh TJI49 and RecETh1h2e YI23) for Burkholderia opens new possibilities for precise genetic manipulation of lspA and the lipoproteins it processes . These systems overcome previous limitations of lambda Red recombination in Burkholderia, which required long homology arms and suffered from low efficiency.

  • Structure-function relationships: Detailed structural characterization of Burkholderia lspA would enhance understanding of species-specific features and enable more targeted inhibitor design. The unique membrane environment of Burkholderia species, characterized by their distinctive lipopolysaccharide structures, likely influences lspA function and inhibitor interactions .

  • Lipoprotein processing networks: Comprehensive identification of lspA substrates across Burkholderia species would reveal how this enzyme contributes to virulence, stress responses, and antimicrobial resistance. This knowledge could identify additional therapeutic targets within the lipoprotein processing pathway.

  • Natural product discovery: The successful activation of cryptic non-ribosomal peptide synthetase biosynthetic gene clusters in Burkholderia using recombinase-assisted in situ insertion of promoters has yielded novel lipopeptides with bioactive properties, including anti-inflammatory activity . Similar approaches could identify natural products with activity against lspA or its substrates.

How might advances in lspA research contribute to broader understanding of bacterial pathogenesis?

Advances in Burkholderia lspA research have far-reaching implications for understanding bacterial pathogenesis more broadly:

  • Conserved lipoprotein processing mechanisms: LspA represents the second enzyme in a conserved lipoprotein processing pathway found across diverse bacterial species. Insights from Burkholderia lspA can illuminate fundamental aspects of this essential pathway in other pathogens .

  • Host-pathogen interaction frameworks: Many bacterial lipoproteins processed by lspA serve as pathogen-associated molecular patterns (PAMPs) recognized by host immune receptors. Research on Burkholderia lipopolysaccharides has demonstrated that LPS from different species induces TLR4-dependent NF-κB responses, though with potentially different magnitudes or kinetics . Understanding how lspA-processed lipoproteins interact with host defenses can inform broader paradigms of host-pathogen dynamics.

  • Antimicrobial resistance mechanisms: As an essential enzyme with no human homolog, lspA represents a novel antibiotic target. Studying resistance mechanisms that may emerge against lspA inhibitors could reveal new insights into bacterial adaptability and guide preemptive strategies for other antimicrobial targets.

  • Structural biology of membrane enzymes: Technical advances in expressing, purifying, and characterizing Burkholderia lspA will contribute methodological approaches applicable to other challenging membrane proteins across bacterial species.

  • Bacterial stress responses: Many lipoproteins processed by lspA participate in stress responses, including adaptation to host environments. Understanding how Burkholderia modulates lipoprotein processing during infection may reveal conserved stress response mechanisms relevant to other pathogens.

The global impact of Burkholderia infections (with an estimated 165,000 cases of melioidosis and 89,000 deaths annually ) underscores the significance of these research directions not only for this specific genus but for addressing the broader challenge of antimicrobial resistance in global public health.

What technological advances would most significantly accelerate lspA research in Burkholderia species?

Several technological advances would substantially accelerate lspA research in Burkholderia species:

  • Advanced genetic tools: While significant progress has been made with RecETh TJI49 and RecETh1h2e YI23 recombineering systems , further refinement of these tools would enable more precise genetic manipulations. Development of Burkholderia-optimized CRISPR-Cas systems would facilitate rapid genome editing, particularly for conditional knockdowns of essential genes like lspA.

  • Membrane protein structural biology platforms: Advances in cryo-electron microscopy specifically optimized for membrane proteins would facilitate structural characterization of Burkholderia lspA in various functional states. This would enable structure-based drug design with greater precision.

  • High-throughput screening platforms: Development of Burkholderia-specific screening systems that combine whole-cell activity with target validation would accelerate the identification of lspA inhibitors with appropriate membrane permeability and selectivity.

  • Microfluidic and single-cell technologies: These would allow real-time monitoring of lspA activity and inhibition in individual bacterial cells, revealing heterogeneity in response to inhibitors and potential resistance mechanisms.

  • Artificial intelligence for inhibitor design: Advanced machine learning approaches trained on lspA structural data and inhibitor binding patterns could predict novel inhibitor scaffolds with optimized properties for penetrating the complex Burkholderia cell envelope.

  • In vivo imaging technologies: Non-invasive methods to track lspA inhibition in animal infection models would bridge the gap between in vitro activity and therapeutic efficacy, accelerating translation to clinical applications.

  • Integrated multi-omics platforms: Systems combining genomics, transcriptomics, proteomics, and metabolomics would provide comprehensive views of how lspA inhibition affects Burkholderia physiology, revealing compensatory mechanisms and potential combination therapy targets.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.