Recombinant Burkholderia sp. Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Burkholderia sp. Membrane Protein Insertase YidC (yidC)

YidC is a universally conserved membrane protein insertase critical for the biogenesis of inner membrane proteins in bacteria. In Burkholderia species, YidC facilitates the co-translational insertion and folding of membrane proteins, either independently or in concert with the Sec translocon. Recombinant YidC from Burkholderia multivorans has been engineered for structural and functional studies, enabling insights into its role in membrane protein biogenesis and lipid organization .

3.2. Functional Roles

  • Membrane Insertase Activity: Mediates insertion of small membrane proteins (e.g., F0c subunit of ATP synthase) .

  • Lipid Scramblase Activity: Facilitates phospholipid translocation between membrane leaflets, linked to membrane morphology .

  • Chaperone Function: Assists in folding multi-pass membrane proteins (e.g., SecG) .

4.1. In Vitro Membrane Insertion Assays

Recombinant YidC enhances insertion efficiency of substrates like Pf3 coat protein and M13 procoat by 1.5–1.8-fold in inverted membrane vesicles (INVs) . Mutations in substrate transmembrane segments (e.g., SecG I20E) reduce YidC dependency, highlighting hydrophobicity-driven recognition .

4.2. Interaction with YibN

YibN, a novel YidC interactor, stabilizes YidC and amplifies its insertase activity. Co-expression with YibN increases production of YidC substrates (e.g., F0c, SecG) and alters lipid metabolism, suggesting regulatory cross-talk .

4.3. Biotechnological Relevance

  • Natural Product Synthesis: Burkholderia YidC homologs are implicated in biosynthetic gene cluster activation, enabling discovery of antimicrobial lipopeptides .

  • Stress Adaptation: In Streptococcus mutans, YidC paralogs (YidC1/YidC2) mitigate acid and metal stress, with cytoplasmic domains dictating substrate specificity .

Comparative Analysis of YidC Paralogs

FeatureB. multivorans YidCS. mutans YidC1/YidC2E. coli YidC
Substrate SpecificitySmall membrane proteins (e.g., F0c)Stress-responsive proteins (e.g., metal transporters)Sec-dependent and -independent substrates
EssentialityNon-essentialYidC2 essential under stressEssential for viability
Structural VariationCytoplasmic rhodanese domainExtended cytoplasmic loops (C1, C2)Conserved TM core
Regulatory PartnersYibNMetal ions (Zn²⁺, Fe²⁺)Sec translocon, SRP

Challenges and Future Directions

  • Mechanistic Insights: The precise role of YidC in lipid scrambling and its interplay with YibN remain unresolved .

  • Therapeutic Potential: Engineering YidC for membrane protein overexpression could optimize industrial enzyme production .

  • Structural Biology: High-resolution cryo-EM studies are needed to map substrate translocation pathways .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate your preference when placing the order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
yidC; Bcep18194_A6520; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-555
Protein Length
full length protein
Species
Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Target Names
yidC
Target Protein Sequence
MDIKRTVLWVIFFMSAVMLYDNWQRSHGRPSMFFPSATQTAPAAAAGGASGTGATTTTAG EVPAAAAGAAPSTTAPAAQAQLVKFSTDVYDGEIDTRGGTLAKLTLKKQGDGKQPDLYIT LFDHTAGHTYLARSGLLGGDFPNHNDVYTQLNPGTTSLTGDQNALKLSFESPVKGGVKVV KTYTFTRGSYVIGVDTKIDNVGTAPVTPTVYMELVRDNTAVETPMFSHTFLGPAVYTDAK HFQKINFSDLDKNKADYVTSADNGWVAMVQHYFASAWIPQQGVKRDIYAEKIDPTLYRVG VKQPVAAIAPGQSADVQARLFAGPEEERMLEGIAPGLELVKDYGWVTIIAKPLFWLLEKI HSYIGNWGWSIVLLTLLIKAVFFPLSAASYKSMARMKEITPRMQALRERFKSDPQKMNSA LMELYKTEKVNPFGGCLPVVIQIPVFISLYWVLLASVEMRGAPWVLWIHDLSQRDPFFIL PVLMAVSMYVQTSLNPTPPDPVQAKMMKFMPIAFSVMFFFFPAGLVLYYVVNNVLSIAQQ YYITRKLGGAKKKPA
Uniprot No.

Target Background

Function
Essential for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in the integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins. Facilitates folding of multispanning membrane proteins.
Database Links
Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of YidC in bacterial membrane protein biogenesis?

YidC functions as a prominent membrane protein insertase that facilitates the integration of proteins into the bacterial inner membrane. It serves dual roles: first, as an independent insertase for smaller membrane proteins, and second, as a partner of the Sec translocon to assist in the proper folding of multi-pass membrane proteins . Additionally, YidC exhibits lipid scramblase activity, contributing to membrane bilayer organization . This membrane protein biogenesis machinery is particularly crucial for maintaining proper membrane integrity and function in bacteria, including Burkholderia species.

The insertion mechanism involves a distinctive structural arrangement where YidC's conserved five transmembrane domains form a substrate-binding groove that facilitates membrane thinning, thus reducing the energy required for translocation . This process is especially important for single-pass or small multi-pass membrane proteins, where YidC can directly mediate insertion without the Sec machinery.

How does the structure of YidC relate to its function?

The structural model of YidC reveals a distinctive arrangement of five conserved transmembrane domains (excluding the non-conserved TM1) arranged like vertices of a pentagon in the order 4-5-3-2-6 when viewed from the cytoplasm . A notable structural feature is the helical hairpin between transmembrane segments TM2 and TM3, forming what researchers term a "helical paddle domain" (HPD) on the cytoplasmic membrane surface .

This structure creates a hydrophilic groove that is exposed to the membrane, facilitating the translocation of membrane proteins into the lipid bilayer . The groove is connected to a mechanism that thins the membrane bilayer, reducing the energy required for translocation. Additionally, this groove is implicated in inter-leaflet membrane lipid scramblase activity . These structural features enable YidC to maintain membrane integrity while assisting in the proper insertion and arrangement of other membrane proteins.

Structural ElementLocationFunction
Transmembrane domainsBacterial inner membraneForm pentagonal arrangement creating substrate binding site
Helical paddle domain (HPD)Between TM2 and TM3Interacts with cytoplasmic side of membrane, may contribute to substrate recognition
Hydrophilic grooveCenter of TM bundleFacilitates protein translocation, reduces energy barrier
Lipid-protein interfaceExterior of YidCProvides insertion site for membrane proteins

What are the known substrate proteins for YidC insertase?

YidC facilitates the insertion of several well-characterized substrate proteins, including:

  • Phage coat proteins: M13 procoat and Pf3 coat proteins have been extensively used as model substrates for studying YidC function .

  • ATP synthase components: The F1-F0 ATP synthase subunit c (F0c) is a key physiological substrate .

  • Small membrane proteins: SecG and potentially other small membrane proteins with fewer transmembrane segments .

Research indicates that YidC preferentially inserts proteins with fewer transmembrane segments and those with less hydrophobic transmembrane domains. For instance, experiments with SecG and its I20E mutant (reducing hydrophobicity of the first transmembrane segment) demonstrated that YidC's insertion efficiency correlates with transmembrane segment hydrophobicity .

How does the recently discovered YibN-YidC interaction influence membrane protein insertion mechanisms?

Recent research using proximity-dependent biotin labeling (BioID) has identified YibN as a crucial interactor within the YidC protein environment . This interaction was further validated through multiple experimental approaches:

  • Affinity purification-mass spectrometry assays conducted on native membranes

  • On-gel binding assays with purified proteins

  • Co-expression studies and in vitro translation/insertion assays

The functional significance of this interaction is substantial, as YibN enhances the production and membrane insertion of YidC substrates. Specifically, YibN was found to increase the synthesis of M13 procoat-Lep, Pf3-23Lep, F0c, and SecG by approximately 1.5-1.8 fold in both in vivo and in vitro assays . The enhancement was less pronounced for SecG I20E mutant, suggesting that transmembrane segment hydrophobicity plays a role in YibN-mediated insertion enhancement.

Furthermore, overproduction of YibN stimulates membrane lipid production and promotes inner membrane proliferation, possibly by interfering with YidC's lipid scramblase activity . This suggests a complex regulatory mechanism where YibN not only enhances YidC's insertase function but also modulates its impact on membrane lipid organization.

What are the evolutionary implications of YidC's conserved structural features across bacterial species, including Burkholderia?

YidC belongs to the "Oxa1 superfamily," which includes related proteins like Oxa1/Alb3 and functionally analogous insertion factors such as EMC3, TMCO1, GET1, and Oxa1L . These proteins share a conserved structure characterized by a membrane-exposed hydrophilic groove that facilitates translocation of membrane proteins into the lipid bilayer.

Evolutionary co-variation analysis has been instrumental in developing structural models of YidC, revealing highly conserved interaction patterns between transmembrane domains . This conservation suggests that the fundamental mechanism of YidC-mediated membrane protein insertion is likely preserved across bacterial species, including Burkholderia.

The bacterial YidC has five conserved transmembrane domains (excluding the non-conserved TM1), which form a core structural element essential for function. When working with recombinant Burkholderia sp. YidC, researchers should expect similar structural arrangements, though species-specific variations in non-conserved regions may influence substrate specificity or interaction partners.

DomainConservationFunctionEvolutionary Significance
TM2-TM6Highly conservedCore insertase functionEssential across bacterial species
Helical paddle domainModerately conservedMembrane interactionMay vary across species, affecting specificity
N-terminal domainVariableSpecies-specific rolesPossible adaptation to different membrane environments

How does ribosome binding to YidC facilitate co-translational membrane protein insertion?

Cryo-electron microscopy reconstruction of a translating YidC-ribosome complex has revealed critical insights into the co-translational mode of YidC-mediated membrane protein insertion . The structural data demonstrates that a single copy of YidC interacts with the ribosome at the ribosomal tunnel exit, positioning the nascent polypeptide chain for direct insertion into the membrane.

This interaction creates a specific insertion site at the YidC protein-lipid interface, where the hydrophilic groove of YidC can guide the nascent membrane protein into the lipid bilayer while reducing the energetic barrier through membrane thinning . The mechanism appears to involve:

  • Initial binding of the ribosome to YidC's cytoplasmic domains

  • Alignment of the ribosomal exit tunnel with YidC's hydrophilic groove

  • Transfer of the nascent polypeptide directly from the ribosome into the YidC insertion site

  • Lateral release of the substrate into the lipid bilayer

For researchers working with recombinant Burkholderia sp. YidC, understanding this co-translational mechanism is essential for designing in vitro translation-insertion assays and interpreting results in the context of ribosome-YidC interactions.

What are the optimal expression and purification strategies for recombinant Burkholderia sp. YidC?

Based on established protocols for E. coli YidC, the following strategies can be adapted for recombinant Burkholderia sp. YidC:

Expression System Selection:

  • E. coli-based expression systems (BL21(DE3), C41(DE3), or C43(DE3)) are commonly used for membrane proteins

  • Expression vectors with tight regulation (pBAD, pET) help control potentially toxic membrane protein expression

  • Consider fusion tags that facilitate detection and purification (His-tag, SPA-tag)

Optimal Growth Conditions:

  • Lower temperatures (16-25°C) often improve membrane protein folding

  • Induction with lower concentrations of inducer (0.1% arabinose, 0.5-0.75 mM IPTG)

  • Rich media supplemented with additional phospholipids may enhance membrane protein yields

Purification Protocol:

  • Membrane isolation through differential centrifugation

  • Solubilization using mild detergents (1% DDM has been successful for YidC)

  • Affinity chromatography using tags (Ni-NTA for His-tagged constructs)

  • Size exclusion chromatography for final purification

Quality Control Measures:

  • SDS-PAGE and Western blotting to confirm expression and purity

  • Circular dichroism to verify proper folding

  • Dynamic light scattering to assess homogeneity

How can researcher establish reliable in vitro assays for measuring YidC insertase activity?

In vitro translation/insertion assays using inverted membrane vesicles (INVs) have proven effective for studying YidC function . For researchers working with Burkholderia sp. YidC, the following methodological approach is recommended:

Preparation of INVs:

  • Express recombinant YidC in appropriate bacterial strain

  • Disrupt cells by French press or sonication

  • Isolate membrane fraction by ultracentrifugation

  • Generate INVs through homogenization and washing steps

In Vitro Translation System:

  • Utilize E. coli S30 extract or commercial cell-free translation systems

  • Include [35S]-methionine for radiolabeling of nascent proteins

  • Supply mRNA encoding YidC substrate proteins (M13 procoat, Pf3 coat, F0c, SecG)

Insertion Assay Setup:

  • Combine translation mixture with INVs

  • Incubate at 37°C for 15-30 minutes

  • Subject to proteinase K treatment to digest non-inserted portions

  • Analyze protected fragments by SDS-PAGE and autoradiography

Quantification Methods:

  • Measure intensities of membrane-protected fragments (MPFs)

  • Compare insertion efficiency between different YidC variants or with/without additional factors (e.g., YibN)

  • Calculate relative insertion efficiency compared to control INVs

SubstrateTypical Insertion TimeDetection MethodExpected Enhancement with YibN
M13 procoat15-30 minutesAutoradiography1.5-1.8 fold
Pf3 coat15-30 minutesAutoradiography1.5-1.8 fold
F0c30-45 minutesAutoradiography1.5-1.8 fold
SecG30-45 minutesAutoradiography1.5-1.8 fold

What approaches can be used to identify and characterize novel interaction partners of Burkholderia sp. YidC?

The discovery of YibN as a YidC interactor demonstrates the value of comprehensive interactome analysis . Researchers investigating Burkholderia sp. YidC can employ similar approaches:

Proximity-Dependent Biotin Labeling (BioID):

  • Construct fusion proteins of YidC with BirA* biotin ligase

  • Express in Burkholderia or heterologous system

  • Add biotin to culture media for 24 hours

  • Isolate membrane fraction and solubilize with detergent

  • Capture biotinylated proteins using avidin-based affinity purification

  • Identify proteins by LC-MS/MS

Affinity Purification-Mass Spectrometry:

  • Express tagged YidC (His-tag, FLAG-tag, SPA-tag)

  • Consider SILAC labeling to distinguish specific from non-specific interactions

  • Perform reciprocal pulldowns to validate interactions

  • Analyze by LC-MS/MS and rank proteins based on enrichment and spectral counts

Validation Approaches:

  • On-gel binding assays with purified proteins

  • Co-expression studies analyzing effects on substrate insertion

  • In vitro translation/insertion assays with and without candidate interactors

  • Microscopy-based co-localization studies

Functional Characterization:

  • Gene knockout or depletion studies to assess physiological relevance

  • Co-expression studies to analyze effects on substrate insertion

  • In vitro reconstitution to determine minimum components needed

  • Structural studies to identify interaction interfaces

How should researchers interpret contradictory results between in vivo and in vitro YidC insertase activity?

When working with recombinant Burkholderia sp. YidC, researchers may encounter discrepancies between in vivo and in vitro results. These contradictions often arise from differences in experimental conditions and system complexity:

Common Discrepancies and Interpretations:

  • Higher in vivo activity but lower in vitro activity: May indicate missing cofactors or interaction partners in the in vitro system

  • Substrate-specific contradictions: Different substrates may require different accessory factors (like YibN for certain substrates)

  • Detergent effects: In vitro systems using detergent-solubilized YidC may disrupt critical lipid interactions

Systematic Troubleshooting Approach:

  • Compare membrane composition between in vivo and in vitro systems

  • Test for the presence and activity of known interactors (e.g., YibN)

  • Evaluate the effects of different detergents or reconstitution into liposomes

  • Consider the impact of transmembrane segment hydrophobicity on insertion requirements

Reconciliation Strategies:

  • Supplement in vitro systems with purified interaction partners

  • Reconstruct more complex membrane environments using defined lipid compositions

  • Employ genetic approaches to validate specific interactions in vivo

What are the key considerations when comparing YidC homologs from different bacterial species?

Researchers studying Burkholderia sp. YidC should be aware of both conserved features and species-specific variations when comparing with other bacterial YidC homologs:

Sequence and Structure Analysis:

  • Focus on the five conserved transmembrane domains (TM2-TM6) as the functional core

  • Analyze conservation of key residues in the hydrophilic groove using multiple sequence alignments

  • Consider evolutionary co-variation patterns to identify functionally linked residue pairs

  • Note species-specific variations in the N-terminal region and periplasmic domains

Functional Comparison Framework:

  • Substrate specificity: Test a panel of standard substrates (M13 procoat, F0c) across homologs

  • Interaction partners: Compare interactomes to identify conserved and species-specific interactors

  • Lipid preferences: Evaluate function in different membrane compositions

  • Cross-complementation: Test ability of homologs to complement YidC depletion in heterologous systems

Species-Specific Adaptations:
The membrane composition of Burkholderia species differs from E. coli, potentially leading to adaptations in YidC function. Burkholderia membranes often contain unique lipids and may exhibit different physical properties, necessitating careful interpretation when comparing across species.

FeatureE. coli YidCPredicted Burkholderia sp. YidC VariationExperimental Approach
Core transmembrane domains5 conserved TMsLikely conservedSequence alignment, structural modeling
N-terminal regionVariableMay contain species-specific domainsTruncation studies, domain swapping
Substrate specificityWell-characterizedMay handle Burkholderia-specific membrane proteinsComparative insertion assays
InteractomeIncludes YibNMay include unique partnersBioID, affinity purification

How might targeting YidC provide new approaches for antimicrobial development against Burkholderia species?

Given YidC's essential role in membrane protein biogenesis, it represents a potential target for novel antimicrobials against Burkholderia species, which include several pathogenic members:

Target Validation Approaches:

  • Conditional depletion studies to confirm essentiality in Burkholderia species

  • Identification of species-specific structural features that could enable selective targeting

  • Evaluation of synergistic effects when targeting YidC alongside other membrane biogenesis pathways

Drug Discovery Methodologies:

  • High-throughput screening of compound libraries against purified Burkholderia YidC

  • Structure-based design targeting the hydrophilic groove or substrate binding sites

  • Peptide inhibitors designed to mimic natural substrates or interaction partners

  • Small molecules that disrupt critical interactions (e.g., YidC-YibN interaction)

Resistance Mechanisms and Mitigation:

  • Evaluate potential for resistance development through target modification

  • Consider dual-targeting approaches to reduce resistance emergence

  • Target conserved regions essential for function to minimize viable mutations

What emerging technologies could advance understanding of YidC's dynamic behavior in living cells?

Several cutting-edge approaches could provide new insights into Burkholderia sp. YidC function:

Advanced Imaging Techniques:

  • Super-resolution microscopy to visualize YidC distribution and dynamics in bacterial membranes

  • Single-molecule tracking to monitor YidC movement and substrate interactions in real-time

  • FRET-based approaches to detect conformational changes during insertion events

Integrative Structural Biology:

  • Cryo-electron tomography of whole cells to visualize YidC in native membrane environments

  • Hydrogen-deuterium exchange mass spectrometry to map dynamic regions

  • Integrative modeling combining data from multiple structural techniques with evolutionary analysis

Systems Biology Approaches:

  • Global proteomic analysis of membrane composition under YidC depletion conditions

  • Transcriptome profiling to identify regulatory networks connected to membrane protein biogenesis

  • Metabolomic studies to assess the impact of YidC function on cellular metabolism

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.