Recombinant Burkholderia sp. Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
mtgA; Bcep18194_A3696; Biosynthetic peptidoglycan transglycosylase; Glycan polymerase; Peptidoglycan glycosyltransferase MtgA; PGT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-245
Protein Length
full length protein
Species
Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Target Names
mtgA
Target Protein Sequence
MVAVSGTQHTRTVSPTRWIVYAGSVFAGAWLATQLFYLAQIALWSFVNPGSTAFMRTDAW WLSRDKPPAQIQHQWVPYDQISRNLKRALIASEDSTFATNNGYDVDAILQAWEKNKARGR IVAGGSTITQQLARNLFLSREKSYIRKGQELIITWMLETVLDKERIFEIYLNSVEWGRGV YGAEAAARYYYRIPASRLGAWQSARLAVMLPKPRWFDAHRGSAYQAQRAAVIARRMGAAE LPQSE
Uniprot No.

Target Background

Function
A peptidoglycan polymerase that catalyzes glycan chain elongation from lipid-linked precursors.
Database Links
Protein Families
Glycosyltransferase 51 family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is Monofunctional Biosynthetic Peptidoglycan Transglycosylase (mtgA) in Burkholderia species?

Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA) is an enzyme that catalyzes the polymerization of lipid II precursors to form linear glycan strands during peptidoglycan biosynthesis in Burkholderia bacteria. Unlike bifunctional peptidoglycan synthases that contain both transglycosylase and transpeptidase domains, mtgA specifically performs only the transglycosylase function. In Burkholderia species, mtgA plays a crucial role in cell wall formation and maintenance, making it essential for bacterial survival and growth.

The enzyme belongs to the glycosyltransferase family 51 (GT51) and contains a characteristic fold with several conserved motifs that are involved in substrate binding and catalysis. Understanding mtgA function is particularly important in Burkholderia research due to the pathogenic nature of several species in this genus, including B. pseudomallei and B. mallei.

What genetic manipulation techniques are available for studying mtgA in Burkholderia species?

Several genetic manipulation techniques have been established for Burkholderia species that can be applied to mtgA research:

  • Gene knockouts via homologous recombination have been performed in several Burkholderia strains for biosynthesis investigations .

  • The Red/ET recombination method has been successfully applied in Burkholderia for gene cluster confirmation .

  • The Flp-FRT recombination system is effective for generating marker-less mutations in Burkholderia .

  • Promoter exchange with rhamnose-inducible or constitutive promoters (like P thaA) can be used to modulate mtgA expression .

  • Transposon mutagenesis has been applied in various biosynthetic gene cluster investigations in Burkholderia .

For mtgA specifically, these techniques can be employed to create knockout mutants, express the gene under controlled conditions, or tag the protein for localization and interaction studies.

What expression systems work best for recombinant production of Burkholderia mtgA?

Based on successful heterologous expression strategies for other Burkholderia proteins, the following systems are recommended for recombinant mtgA production:

  • E. coli expression systems: Several Burkholderia genes have been successfully expressed in E. coli, including lasso peptides and polyketide-nonribosomal peptides . For mtgA, E. coli BL21(DE3) with pET-based vectors containing T7 promoters often yields good expression.

  • Pseudomonas aeruginosa: This has been used as a heterologous host for certain Burkholderia nonribosomal peptides , and may be suitable for mtgA expression when E. coli systems are suboptimal.

  • Native Burkholderia expression: For proteins that are difficult to express heterologously, modified expression in native Burkholderia hosts using inducible promoters can be effective. The rhamnose-inducible promoter and the constitutive P thaA promoter have been successfully used to control gene expression in Burkholderia .

Expression SystemAdvantagesLimitationsOptimized Conditions
E. coli BL21(DE3)High yield, simple protocolsPotential inclusion body formationInduction at OD600=0.5-0.8, 16-18°C overnight
P. aeruginosaSimilar to native environmentMore complex genetic manipulationStrain-specific optimization required
Native BurkholderiaNative folding and modificationsPathogenicity concerns, slower growthRhamnose induction (0.2%) for controlled expression

What are the optimal protocols for genetic manipulation of mtgA in Burkholderia thailandensis?

Genetic manipulation of mtgA in B. thailandensis can be performed using the following optimized protocols:

For Conjugation and DNA Transfer:

  • Grow overnight cultures of B. thailandensis in rich medium .

  • For natural transformation, dilute the overnight culture 1:50 in M63 minimal medium .

  • Incubate at 37°C until OD600 reaches 0.5 (approximately 4-5 hours) .

  • Pellet the culture and resuspend in fresh M63 medium at 1/20th of the original volume .

  • Mix 50 μl cell suspension with at least 100 ng purified DNA containing your mtgA construct .

  • Allow 30 minutes at room temperature for DNA uptake, then add fresh M63 medium and incubate overnight .

For FRT-Based Marker Excision:

  • After successful integration of your mtgA construct with FRT-flanked antibiotic markers, introduce the pFlpe4 or pFlpTet plasmid .

  • These plasmids contain rhamnose-inducible flp recombinase genes and are temperature-sensitive, replicating in Burkholderia at 30°C .

  • Induce with rhamnose to activate the Flp recombinase, which will excise the marker between FRT sites.

  • Shift to 37°C to cure the plasmid after marker excision.

These protocols can be used to:

  • Generate mtgA knockout mutants

  • Create mtgA overexpression strains

  • Introduce point mutations to study structure-function relationships

  • Add epitope tags for protein localization and interaction studies

How can I optimize the purification of recombinant mtgA from Burkholderia for structural studies?

Optimizing the purification of recombinant mtgA from Burkholderia for structural studies requires addressing several challenges inherent to membrane-associated enzymes:

  • Expression optimization:

    • Use inducible promoter systems such as rhamnose-inducible or arabinose-inducible promoters for controlled expression .

    • Consider expressing a truncated form of mtgA lacking the transmembrane domain to improve solubility while retaining catalytic activity.

  • Extraction and solubilization:

    • Test various detergents for optimal solubilization (CHAPS, DDM, LDAO)

    • Employ gentle extraction methods to maintain protein folding and activity

  • Purification strategy:

    • Implement a multi-step purification approach:
      a) Affinity chromatography (His-tag or other fusion tags)
      b) Ion-exchange chromatography
      c) Size-exclusion chromatography

  • Stabilization for crystallization:

    • Screen various buffer conditions (pH 6.5-8.0 typically works well)

    • Test stabilizing additives (glycerol 5-10%, reducing agents)

    • Consider co-purification with substrate analogs or inhibitors

Purification StageRecommended ConditionsCritical ParametersQuality Control
Cell lysisFrench press or sonication in buffer with 20 mM HEPES pH 7.5, 300 mM NaCl, 10% glycerolTemperature control (<4°C)Microscopic examination
Membrane extraction1% DDM or 1% CHAPS, gentle stirring for 1h at 4°CDetergent:protein ratioWestern blot
Affinity purificationIMAC with imidazole gradient (20-300 mM)Flow rate, washing stepsSDS-PAGE
Size exclusionSuperdex 200, buffer with 0.05% DDMSample concentrationDynamic light scattering

What enzymatic assays are most reliable for measuring mtgA activity in vitro?

Several robust assays can be employed to measure mtgA transglycosylase activity in vitro:

  • Fluorescent Lipid II substrate assay:

    • Uses dansylated or NBD-labeled Lipid II analogs

    • Polymerization results in detectable fluorescence changes

    • Allows real-time monitoring of enzyme kinetics

  • HPLC-based assays:

    • Separates and quantifies reaction products

    • High sensitivity and reproducibility

    • Can detect various glycan strand lengths

  • Radioactive assays:

    • Uses radiolabeled precursors ([14C]-labeled GlcNAc)

    • Quantifies incorporation into polymeric peptidoglycan

    • Considered the gold standard for sensitivity

  • Coupling with transpeptidase reactions:

    • Measures complete peptidoglycan assembly

    • Useful for studying interactions between transglycosylase and transpeptidase activities

    • More closely mimics in vivo conditions

For most academic research purposes, the fluorescent Lipid II assay offers the best balance of sensitivity, safety, and ease of implementation. This method typically uses Lipid II analogs with a fluorescent moiety attached to the peptide stem, allowing detection of polymerization through changes in fluorescence intensity or anisotropy.

How should researchers address inconsistent results in mtgA activity assays?

When faced with inconsistent results in mtgA activity assays, researchers should implement a systematic troubleshooting approach:

  • Enzyme quality assessment:

    • Verify protein purity via SDS-PAGE and Western blotting

    • Confirm protein folding using circular dichroism

    • Assess aggregation state with size exclusion chromatography or dynamic light scattering

  • Substrate verification:

    • Analyze Lipid II quality by mass spectrometry

    • Test substrate with a validated control enzyme

    • Ensure proper substrate solubilization and handling

  • Reaction conditions optimization:

    • Perform a multifactorial analysis of:

      • pH ranges (typically 6.5-8.0)

      • Divalent cation concentrations (Mg²⁺, Mn²⁺, Ca²⁺)

      • Detergent types and concentrations

      • Temperature (25-37°C)

      • Buffer composition

  • Statistical approach:

    • Implement more rigorous statistical designs like Latin square

    • Increase technical and biological replicates

    • Calculate the minimum sample size needed for statistical significance based on preliminary data variance

When analyzing inconsistent results, hypothesis-generating approaches are often more valuable than hypothesis-confirming ones. Consider using analytical tools like principal component analysis to identify variables that most strongly influence assay outcomes.

What comparative genomics approaches can reveal insights about mtgA function in Burkholderia species?

Comparative genomics offers powerful approaches to understanding mtgA function in Burkholderia:

  • Phylogenetic analysis:

    • Construct phylogenetic trees of mtgA sequences across Burkholderia species

    • Compare with other bacterial genera to identify Burkholderia-specific adaptations

    • Correlate phylogenetic patterns with ecological niches or pathogenicity

  • Synteny analysis:

    • Examine the genomic context of mtgA in different Burkholderia species

    • Identify conserved gene neighborhoods that may indicate functional relationships

    • Look for co-evolution patterns with other cell wall biosynthesis genes

  • Structural prediction and comparison:

    • Generate homology models of mtgA from different Burkholderia species

    • Compare predicted active sites and substrate-binding pockets

    • Identify species-specific structural features that may relate to function

  • Gene expression correlation networks:

    • Analyze transcriptomic data to identify genes co-regulated with mtgA

    • Look for expression patterns under different growth conditions or stresses

    • Build functional networks based on co-expression data

These approaches can reveal evolutionary adaptations of mtgA in Burkholderia that may relate to their diverse ecological niches and pathogenic potential. For instance, comparative analysis might reveal differences in enzyme properties between environmental Burkholderia species and pathogenic species like B. pseudomallei and B. mallei .

How can structural biology approaches enhance our understanding of Burkholderia mtgA?

Structural biology approaches provide critical insights into mtgA function and can guide rational drug design:

  • X-ray crystallography challenges and solutions:

    • Challenge: Membrane-associated enzymes like mtgA are difficult to crystallize

    • Solutions:

      • Truncate transmembrane regions while preserving catalytic domains

      • Use lipidic cubic phase crystallization methods

      • Co-crystallize with inhibitors or substrate analogs to stabilize the structure

  • Cryo-electron microscopy (cryo-EM):

    • Single-particle analysis for high-resolution structures

    • Visualization of mtgA in different conformational states

    • Study of mtgA in complex with other cell wall synthesis machinery

  • NMR spectroscopy:

    • Analyze dynamic regions and conformational changes

    • Study interactions with substrates and inhibitors

    • Investigate the effects of specific mutations on protein structure

  • Molecular dynamics simulations:

    • Model substrate binding and catalytic mechanisms

    • Simulate enzyme flexibility and conformational changes

    • Predict effects of mutations or inhibitor binding

  • Integrative structural biology:

    • Combine multiple methods (X-ray, cryo-EM, NMR, SAXS)

    • Generate comprehensive structural models

    • Connect structural features to functional properties

Structural information can guide the design of selective inhibitors targeting Burkholderia mtgA, which could be valuable for developing new antimicrobials against pathogenic Burkholderia species.

What are the most effective strategies for generating and validating mtgA knockout mutants in Burkholderia species?

Creating and validating mtgA knockout mutants in Burkholderia species requires careful experimental design:

  • Knockout strategy selection:

    • Complete gene deletion via homologous recombination

    • Insertional inactivation using antibiotic resistance cassettes

    • In-frame deletions to minimize polar effects on adjacent genes

    • CRISPR-Cas9 mediated editing (emerging technique for Burkholderia)

  • Construction of knockout vectors:

    • Include 1-1.5 kb homology arms flanking the mtgA gene

    • Incorporate FRT-flanked antibiotic resistance cassettes for later marker removal

    • Consider counter-selection markers (e.g., sacB) for efficient selection

  • Genetic manipulation procedures:

    • Use established protocols for conjugation or natural transformation in B. thailandensis

    • For pathogenic species, work in appropriate biosafety facilities

    • Apply the Flp-FRT recombination system for marker excision after confirmation

  • Rigorous validation approaches:

    • PCR verification of the expected genetic modification

    • Whole-genome sequencing to confirm single-site integration and absence of off-target effects

    • RT-PCR or RNA-seq to confirm absence of mtgA expression

    • Western blotting to verify absence of mtgA protein

    • Complementation studies to confirm phenotypes are specifically due to mtgA loss

  • Phenotypic characterization:

    • Growth kinetics under different conditions

    • Cell morphology analysis (microscopy with cell wall stains)

    • Antibiotic susceptibility testing

    • Muropeptide analysis of peptidoglycan composition

    • Biofilm formation capacity

For essential genes like mtgA, conditional knockouts may be necessary, using inducible promoters like the rhamnose-inducible system mentioned in the search results .

How can researchers effectively study the role of mtgA in Burkholderia pathogenesis?

Investigating mtgA's role in Burkholderia pathogenesis requires multifaceted approaches:

  • Controlled expression systems:

    • Create strains with tunable mtgA expression using rhamnose-inducible or arabinose-inducible promoters

    • Develop depletion strains to study the effects of gradually reducing mtgA levels

    • Use promoter replacement strategies as described for other Burkholderia genes

  • Infection models:

    • Cell culture-based models to study host-pathogen interactions

    • Invertebrate models (Galleria mellonella, Caenorhabditis elegans)

    • Mammalian models aligned with the specific Burkholderia species pathogenicity

  • Virulence assessment:

    • Analyze bacterial survival in macrophages

    • Measure bacterial dissemination in infection models

    • Assess host immune responses to wild-type vs. mtgA-modified strains

    • Determine LD50 values for comparative virulence

  • Cell wall analysis:

    • Study changes in peptidoglycan structure using HPLC and mass spectrometry

    • Analyze cell wall integrity under host-relevant stress conditions

    • Investigate interactions between modified cell walls and host immune components

  • Immune evasion mechanisms:

    • Examine recognition by pattern recognition receptors

    • Assess activation of NOD1/NOD2 pathways by cell wall fragments

    • Study resistance to host antimicrobial peptides

When studying B. pseudomallei or B. mallei pathogenesis, researchers must consider the multiple infection routes (percutaneous, inhalation, or ingestion) as mentioned in search result . The immune responses, particularly IgA titers and the presence of Th17 cells, are important considerations for these pathogens .

What approaches can help overcome challenges in heterologous expression of Burkholderia mtgA?

Heterologous expression of Burkholderia proteins including mtgA can be challenging due to their unique properties. Here are strategies to overcome common obstacles:

  • Codon optimization:

    • Adapt codon usage to the expression host

    • Remove rare codons that might cause translation pausing

    • Optimize GC content for improved expression

  • Fusion partners and solubility tags:

    • MBP (Maltose Binding Protein) for improved solubility

    • SUMO tag for enhanced expression and native N-terminus after cleavage

    • Thioredoxin for disulfide bond formation assistance

  • Expression host selection:

    • E. coli strains optimized for membrane proteins (C41, C43)

    • Pseudomonas aeruginosa for better compatibility with Burkholderia proteins

    • Cell-free expression systems for toxic proteins

  • Domain engineering:

    • Express catalytic domain only, removing transmembrane segments

    • Create chimeric proteins with well-expressed homologs

    • Structure-guided truncation design

  • Expression conditions optimization:

    • Low-temperature induction (16-20°C)

    • Reduced inducer concentrations

    • High osmolarity media to improve membrane protein folding

    • Addition of specific ligands or inhibitors during expression

  • Post-expression handling:

    • Optimize lysis conditions (detergents, buffer compositions)

    • Rapid purification to minimize degradation

    • Addition of stabilizing agents during purification

Successful heterologous expression of other Burkholderia proteins in E. coli and P. aeruginosa systems, as mentioned in search result , provides precedent for mtgA expression, though protein-specific optimization will be necessary.

How can structural information about mtgA inform antimicrobial development against pathogenic Burkholderia species?

Structural insights into Burkholderia mtgA can guide antimicrobial development through several approaches:

  • Structure-based drug design:

    • Identify unique structural features in Burkholderia mtgA compared to human or probiotic bacterial homologs

    • Target species-specific binding pockets for selective inhibition

    • Design transition state analogs based on enzyme mechanism

  • Fragment-based screening:

    • Use crystallography or NMR to identify small molecule fragments that bind to mtgA

    • Develop these fragments into lead compounds through medicinal chemistry

    • Optimize binding affinity and specificity through structure-guided modifications

  • Mechanism-based inhibitor development:

    • Design covalent inhibitors that react with catalytic residues

    • Create substrate analogs that compete for the active site

    • Develop allosteric inhibitors that disrupt protein dynamics

  • Combination therapy approaches:

    • Target multiple peptidoglycan biosynthesis enzymes simultaneously

    • Develop synergistic compounds that enhance existing antibiotics

    • Create dual-action molecules that inhibit both transglycosylase and transpeptidase activities

Given the pathogenic nature of B. pseudomallei and B. mallei , developing specific inhibitors against their cell wall biosynthesis machinery could provide valuable therapeutic options. The distinct pathogenesis mechanisms of these species, as highlighted in search result , suggest that targeting their cell wall biosynthesis could effectively disrupt infection processes.

What role does mtgA play in Burkholderia biofilm formation and antibiotic resistance?

The role of mtgA in Burkholderia biofilm formation and antibiotic resistance is complex and multifaceted:

  • Biofilm matrix contribution:

    • Peptidoglycan fragments may serve as structural components in the biofilm matrix

    • Altered peptidoglycan structure can influence cell adhesion properties

    • mtgA activity may affect the release of cell wall fragments that trigger biofilm formation

  • Cell morphology and biofilm architecture:

    • Changes in mtgA expression alter cell shape and size

    • Modified cell morphology impacts biofilm structure and stability

    • Growth pattern alterations affect three-dimensional biofilm architecture

  • Antibiotic resistance mechanisms:

    • Modified peptidoglycan structure can reduce binding of cell wall-targeting antibiotics

    • Altered cell wall density can affect penetration of various antibiotics

    • Cell wall stress responses triggered by impaired mtgA function may upregulate efflux pumps

  • Resistance to host defense mechanisms:

    • Modified peptidoglycan can show different susceptibilities to host lysozyme

    • Altered cell wall fragments may differently activate host immune responses

    • Changes in surface properties affect resistance to antimicrobial peptides

To study these aspects, researchers can create conditional mtgA expression strains using the inducible promoter systems described in search result , then analyze biofilm formation and antibiotic resistance under various expression conditions.

How can systems biology approaches enhance our understanding of mtgA function in the context of Burkholderia cell wall biosynthesis?

Systems biology provides powerful frameworks for understanding mtgA within the broader context of Burkholderia cellular processes:

These approaches can help identify optimal drug targets or combinations that would effectively disrupt Burkholderia cell wall synthesis, potentially leading to new therapeutic strategies against pathogenic species like B. pseudomallei and B. mallei .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.