Recombinant Burkholderia sp. NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
nuoA; Bcep18194_A5577; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-119
Protein Length
full length protein
Species
Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Target Names
nuoA
Target Protein Sequence
MNLAAYYPVLLFLLVGTGLGIALVSIGKLLGPNKPDVEKNAPYECGFEAFEDARMKFDVR YYLVAILFIIFDLETAFLFPWGVALRDIGWPGFIAMMIFLLEFLLGFAYIWKKGGLDWE
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediaries. In this organism, ubiquinone is believed to be the immediate electron acceptor. This redox reaction is coupled to proton translocation; four protons are translocated across the cytoplasmic membrane for every two electrons transferred, thereby conserving redox energy as a proton gradient.
Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is NADH-quinone oxidoreductase subunit A (nuoA) and where is it located in Burkholderia sp.?

NADH-quinone oxidoreductase subunit A (nuoA) is a critical component of the bacterial respiratory complex I (also called NADH dehydrogenase type 1). In Burkholderia species, nuoA is encoded within the nuo operon, which contains 14 genes encoding the different subunits of the NADH dehydrogenase complex. The nuoA protein specifically consists of 119 amino acids and functions as one of the membrane-embedded subunits of this larger enzymatic complex . The protein contributes to the electron transport chain machinery that couples NADH oxidation to proton translocation across the bacterial membrane, ultimately contributing to ATP synthesis.

What are the genetic characteristics of the nuoA gene in the nuo operon?

The nuoA gene is part of the nuo locus, which encodes all 14 Nuo subunits comprising the bacterial complex I. Genetic analyses have mapped the precise location and organization of the nuo operon in various bacterial species. In the nuo operon, nuoA is typically positioned near the 5' end alongside other membrane-embedded subunit genes . The gene order and organization are highly conserved across species, reflecting the evolutionary importance of maintaining the proper assembly of this respiratory complex. Genetic studies typically employ site-directed mutagenesis approaches to study nuoA function, as seen in the construction of various nuo deletion mutants in model organisms .

What expression systems yield optimal results for recombinant Burkholderia sp. nuoA production?

The most successful expression system documented for recombinant Burkholderia sp. nuoA production utilizes E. coli as the host organism. A standard approach employs an N-terminal His-tag fusion construct, allowing for efficient purification through affinity chromatography . The optimal expression conditions must account for the membrane-associated nature of nuoA, which can challenge conventional soluble protein expression approaches. When designing expression constructs, researchers should consider:

Expression ParameterRecommended ApproachRationale
Host strainE. coli BL21(DE3)Deficient in proteases that might degrade recombinant protein
Fusion tagN-terminal His-tagFacilitates purification without interfering with protein folding
Induction temperature18-25°CLower temperatures improve proper folding of membrane proteins
Expression time12-18 hoursExtended expression at lower temperatures enhances yield
Media supplementation0.5-1% glucoseSuppresses basal expression before induction

What purification challenges are specific to recombinant nuoA and how can they be addressed?

Purification of recombinant nuoA presents specific challenges due to its hydrophobic nature as a membrane protein component. Researchers should implement a multi-step purification strategy that begins with affinity chromatography utilizing the N-terminal His-tag . Critical considerations include:

  • Choice of detergents: Mild non-ionic detergents (DDM, LDAO) help solubilize nuoA while preserving structural integrity

  • Buffer optimization: Including glycerol (10-15%) and reducing agents stabilizes the protein during purification

  • Purification sequence: Affinity chromatography followed by size exclusion chromatography yields highest purity

  • Temperature control: Maintaining all purification steps at 4°C minimizes protein degradation

  • Protease inhibitors: Including a cocktail of inhibitors prevents proteolytic degradation during extraction

Researchers should validate purification success through SDS-PAGE, Western blotting, and activity assays to ensure both purity and functionality of the isolated recombinant nuoA.

How can researchers measure and validate nuoA activity within the NADH dehydrogenase complex?

Measuring nuoA activity presents challenges since it functions as part of a larger complex rather than as an individual enzyme. Researchers typically employ these complementary approaches:

  • Whole complex activity assays: Measure NADH oxidation spectrophotometrically by monitoring absorbance changes at 340 nm in membrane preparations containing the intact complex

  • Respiratory chain analysis: Assess oxygen consumption rates using oxygen electrodes in wild-type vs. nuoA mutant strains

  • Complementation studies: Restore function in nuoA-deficient strains by expressing recombinant nuoA and measuring recovery of NADH dehydrogenase activity

Studies in related bacterial systems report typical NADH oxidation activities around 1.2 U mg protein−1 for wild-type strains . When assessing activity, researchers should establish clear baselines using both positive controls (wild-type membranes) and negative controls (membranes from nuo deletion strains) .

What mutagenesis approaches yield the most valuable insights about nuoA function?

Strategic mutagenesis of nuoA provides crucial functional insights. Based on established protocols with other nuo subunits, researchers should consider:

  • Site-directed mutagenesis targeting conserved residues: Identify essential amino acids by creating point mutations at highly conserved positions

  • Domain deletion analysis: Generate truncated versions (like the 235-bp deletion approach used for nuoG) to determine functional domains

  • Chimeric constructs: Replace portions of nuoA with corresponding regions from homologous proteins to identify specificity determinants

  • Random mutagenesis followed by functional screening: Create libraries of nuoA variants to identify residues affecting activity or stability

When designing mutagenesis strategies, researchers should utilize techniques such as overlap extension PCR for precise modifications and validate all constructs by sequencing before functional testing .

How does deletion of nuoA compare to deletion of other nuo subunits in affecting bacterial physiology?

Comparative analysis of various nuo subunit deletion mutants reveals nuanced impacts on bacterial physiology. Research with related systems shows:

MutantGrowth PhenotypeRespiratory ActivityNADH Oxidation RatePhysiological Impact
ΔnuoAImpaired growthReduced oxygen consumptionDecreasedPart of essential membrane domain
Δndh-1Wild-type-like growthNormal oxygen consumption~1.2 U mg protein−1Compensated by redundant systems
Δndh-2Wild-type-like growthNormal oxygen consumption~1.2 U mg protein−1Compensated by redundant systems
ΔΔndhSeverely impairedStagnating oxygen transfer rateSignificantly decreasedCannot maintain redox homeostasis

This pattern suggests that while single NADH dehydrogenase type 2 enzymes may be dispensable due to redundancy, complete nuo complex function is critical . The specific deletion of nuoA likely disrupts the assembly of the membrane domain of complex I, affecting proton translocation. Researchers investigating nuoA deletion effects should monitor both growth parameters and respiratory indicators including oxygen transfer rate (OTR) and CO2 transfer rate (CTR) .

How can researchers overcome protein aggregation and poor solubility when working with recombinant nuoA?

Membrane proteins like nuoA frequently present solubility challenges during recombinant expression and purification. To address these issues, researchers should implement:

  • Optimized extraction protocols:

    • Use gentle detergents (CHAPS, DDM) at concentrations just above their critical micelle concentration

    • Extract at 4°C with constant gentle agitation

    • Include stabilizing agents like glycerol (10-15%) in extraction buffers

  • Expression optimization:

    • Reduce expression temperature to 16-18°C

    • Use lower inducer concentrations for slower, more controlled expression

    • Consider specialized E. coli strains designed for membrane protein expression (C41, C43)

  • Fusion partners that enhance solubility:

    • MBP (maltose-binding protein) fusions often improve membrane protein solubility

    • SUMO fusion systems allow for tag removal without leaving residual amino acids

  • Buffer screening:

    • Systematically test different pH conditions (6.5-8.0)

    • Evaluate various salt concentrations (100-500 mM)

    • Assess stabilizing additives (glycerol, arginine, trehalose)

When aggregation occurs despite these measures, researchers can attempt mild denaturation followed by controlled refolding, though this approach typically yields lower recovery of functional protein.

What approaches help distinguish between specific nuoA effects and compensatory responses when analyzing mutants?

Distinguishing direct nuoA effects from compensatory responses requires sophisticated experimental design:

  • Time-course analysis:

    • Monitor cellular parameters immediately following nuoA disruption

    • Compare with long-term adapted cultures to identify adaptive responses

    • Use techniques like time-resolved transcriptomics to capture dynamic responses

  • Complementation controls:

    • Restore nuoA under inducible control to confirm phenotype reversal

    • Use point mutants with specific defects to map structure-function relationships

    • Employ heterologous complementation with nuoA from different species to assess functional conservation

  • Metabolic flux analysis:

    • Use isotope labeling to trace metabolic rewiring in nuoA mutants

    • Combine with respiratory measurements to map energy generation pathways

    • Identify alternative NADH oxidation routes activated in response to nuoA deletion

  • Conditional expression systems:

    • Control nuoA expression levels using inducible promoters

    • Create partial loss-of-function through titrated expression

    • Monitor dose-dependent phenotypic responses

Research in P. taiwanensis demonstrated that when NADH dehydrogenase function is compromised, bacteria maintain remarkably stable NADH oxidation rates through compensatory mechanisms, highlighting the metabolic flexibility that might obscure direct nuoA effects .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.