Recombinant Burkholderia sp. NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
nuoK; Bcep18194_A5567; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Target Names
nuoK
Target Protein Sequence
MLTLAHYLVLGAILFAIAIVGIFLNRRNVIIILMSIELMLLAVNTNFVAFSHYLGDVHGQ IFVFFVLTVAAAEAAIGLAILVTLFRKLDTINVEDLDQLKG
Uniprot No.

Target Background

Function

NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediates. In this organism, ubiquinone is believed to be the immediate electron acceptor. This redox reaction is coupled with proton translocation; four hydrogen ions are translocated across the cytoplasmic membrane for every two electrons transferred, conserving energy as a proton gradient.

Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the taxonomic and ecological significance of Burkholderia species in research contexts?

Burkholderia represents a diverse genus of Gram-negative bacteria found in soil, water, plants, and sometimes as opportunistic pathogens. From a research perspective, Burkholderia species are significant for several reasons. The Burkholderia cepacia complex (Bcc) comprises multiple species that have been isolated from various environmental sources, including the rhizosphere of medicinal plants. Recent investigations have expanded our understanding of Burkholderia diversity, revealing its substantial biosynthetic capacity and ability to produce specialized metabolites with antimicrobial properties. A collection of 35 Burkholderia strains isolated from medicinal plant rhizospheres in the Western Ghats of India were all identified as members of the Bcc group. Notably, antimicrobial activity screening demonstrated that approximately 74% (26 of 35) of these strains exhibited antagonistic activity against human and plant pathogens .

Researchers should note that certain Burkholderia lineages possess significant clinical relevance. For instance, seven B. cenocepacia strains from the recA IIIA lineage have been isolated from environmental sources, providing insight into potential environmental reservoirs for these virulent strains that are known to cause severe infections in individuals with cystic fibrosis .

What is the structure and function of NADH-quinone oxidoreductase (NDH-1), and what specific role does the NuoK subunit play?

NADH-quinone oxidoreductase (NDH-1) is a multi-subunit enzyme complex that catalyzes the transfer of electrons from NADH to quinones while coupling this process to proton translocation across the membrane. This energy-transducing mechanism is fundamental to bacterial respiratory chains and contributes significantly to cellular energy production.

The NuoK subunit is particularly intriguing as it is one of the least conserved subunits of NDH-1, yet it houses critical residues essential for the complex's energy-transducing function. NuoK has been speculated to show sequence similarity to the MrpC subunit of multisubunit Na+/H+ antiporters, suggesting potential evolutionary relationships between these proton-translocating systems .

Within the NDH-1 complex, NuoK plays a crucial role in the coupling mechanism, particularly in proton translocation. Research has demonstrated that NuoK contains charged residues that participate, either directly or indirectly, in the energy-coupling mechanism of NDH-1, working in conjunction with other subunits such as NuoA and NuoJ .

What are the critical conserved residues in NuoK and their contribution to protein function?

The NuoK subunit contains two key glutamate residues that are critical for its function: Glu-36 and Glu-72. These residues are positioned in the middle of transmembrane helices TM2 and TM3, respectively. Experimental evidence demonstrates their functional significance:

  • Glu-36: This residue is perfectly conserved among all species studied. Mutations E36A and E36Q result in almost complete abolishment of energy-transducing NDH-1 activities, highlighting its essential role in the functional mechanism of the complex .

  • Glu-72: This residue is almost perfectly conserved across species. Mutations E72A and E72Q cause partial but significant loss of activities, indicating its important though not absolutely essential contribution to function .

Neither of these conserved glutamate residues is present in the MrpC subunit of multisubunit Na+/H+ antiporters, suggesting they represent specific adaptations in the NuoK subunit related to its role in NDH-1 .

In addition to these glutamate residues, the cytoplasmic loop-1 of NuoK contains three residues (Arg-25, Arg-26, and Asn-27) that also contribute to energy-transducing electron transfer and NDH-1 architecture. Among these, Arg-25 is well conserved across species .

What site-directed mutagenesis approaches are most informative for studying NuoK function?

Site-directed mutagenesis represents a powerful experimental approach for elucidating the functional significance of specific residues within the NuoK subunit. Based on current research, several mutagenesis strategies have proven particularly informative:

  • Alanine substitution mutagenesis: Replacing charged residues with alanine (e.g., E36A, E72A) provides fundamental insights into the essentiality of specific residues by eliminating their charged functional groups while minimizing structural perturbations .

  • Conservative substitution mutagenesis: Replacing residues with amino acids of similar properties (e.g., E36Q, E72Q, R25K, R26K) helps distinguish between the importance of the specific amino acid versus its general physicochemical properties .

  • Positional shifting mutagenesis: A particularly innovative approach involves systematically relocating key residues along transmembrane helices. For NuoK, studies systematically relocated Glu-36 along TM2 (EAE1 to EAE10) and Glu-72 along TM3 (EAE11 to EAE18) to test positional flexibility and spatial requirements .

The results from positional shifting experiments revealed interesting functional flexibility. For Glu-36, mutations EAE2, EAE7, EAE8, and EAE9 (corresponding to relocations to positions 32, 38, 39, and 40, respectively) largely preserved NDH-1 activities. Notably, positions 32 and 39 represent locations one helix turn downstream and upstream from the native Glu-36 position, suggesting some degree of site flexibility within the helical structure .

Similarly, for Glu-72, the EAE17 mutant, which shifted the residue upstream by one helix turn, maintained substantial NDH-1 activity .

How can researchers effectively assess proper assembly of the NDH-1 complex containing recombinant or mutated NuoK?

Proper assessment of NDH-1 complex assembly is critical when working with recombinant or mutated NuoK subunits to distinguish between assembly defects and functional defects. Current research demonstrates several effective methodological approaches:

  • Immunoblotting analysis: This technique allows researchers to verify the presence and relative abundance of specific subunits. All NuoK loop-1 mutants studied showed subunit contents similar to wild-type when analyzed by immunoblotting, confirming proper expression .

  • Blue Native Polyacrylamide Gel Electrophoresis (BN-PAGE): This method separates intact protein complexes and can be coupled with activity staining to visualize assembled and functional NDH-1 complexes. For NuoK mutants, BN-PAGE with NADH dehydrogenase activity staining provides visual confirmation of complex assembly .

  • Enzyme activity assays: The dNADH-K3Fe(CN)6 reductase activity assay provides a preliminary assessment of proper complex assembly, as this activity is largely independent of the energy-coupling function. Most NuoK mutants exhibited normal or near-normal dNADH-K3Fe(CN)6 reductase activity despite having significant defects in energy-transducing functions, indicating that the complex was properly assembled but functionally compromised .

Assessment MethodInformation ProvidedExample Application
ImmunoblottingSubunit content verificationAll loop-1 mutants showed wild-type-like subunit content
BN-PAGE with activity stainingVisual confirmation of assembled complexNDH-1 band visible but with reduced intensity in loop-1 mutants
dNADH-K3Fe(CN)6 reductase assayAssembly verification independent of energy couplingMost loop-1 mutants showed comparable activity to wild-type

Table 1: Methods for assessing proper assembly of NDH-1 complex containing recombinant or mutated NuoK subunits

What methodologies are most effective for measuring energy-transducing activities of NuoK variants?

Measuring the energy-transducing activities of NDH-1 containing NuoK variants requires methodologies that specifically assess the coupling between electron transfer and proton translocation. Current research utilizes several complementary approaches:

  • dNADH oxidase activity assay: This assay measures the rate of oxygen consumption coupled to NADH oxidation and serves as an indicator of the complete, coupled electron transport chain function .

  • dNADH-DB reductase activity assay: This assay measures electron transfer to decylubiquinone (DB), a hydrophobic quinone acceptor, and provides a more specific assessment of energy-coupled NDH-1 function compared to the artificial electron acceptor ferricyanide .

  • Proton translocation measurements: Direct measurement of proton movement across the membrane provides the most definitive assessment of the coupling mechanism but requires specialized techniques not detailed in the available search results.

MutantDescriptionEnergy-transducing Activity
Wild-typeNative NuoK100% (reference)
E36AAlanine substitution at position 36Nearly complete loss
EAE2Glu-36 relocated to position 32Largely preserved
EAE7Glu-36 relocated to position 38Largely preserved
EAE8Glu-36 relocated to position 39Largely preserved
EAE9Glu-36 relocated to position 40Largely preserved
E72AAlanine substitution at position 72Partial loss
EAE17Glu-72 shifted one helix turn upstreamActivity similar to wild-type

Table 2: Energy-transducing activities of selected NuoK variants

How should researchers approach contradictory data when analyzing NuoK function?

When researchers encounter data that contradicts their hypotheses about NuoK function, a systematic approach is essential. Based on methodological best practices, researchers should:

This systematic approach is particularly important for complex membrane proteins like NuoK, where multiple factors including expression, membrane insertion, complex assembly, and functional coupling all contribute to the observed phenotype.

What critical controls should be included in experiments involving NuoK mutations?

When designing experiments to study NuoK function through mutagenesis, several critical controls are essential to ensure valid interpretation of results:

  • Wild-type control: All experiments must include the wild-type NuoK as a positive control and reference point for normalizing activity measurements .

  • Assembly controls: Because NDH-1 function requires proper complex assembly, controls that specifically verify assembly are critical. These include:

    • Immunoblotting to confirm subunit content

    • BN-PAGE with activity staining to visualize assembled complexes

    • dNADH-K3Fe(CN)6 reductase activity to verify electron transfer capability independent of energy coupling

  • Conservative and non-conservative mutations: Including both types of mutations (e.g., E36Q and E36A) helps distinguish between the importance of specific chemical properties versus the presence of any charged residue .

  • Negative controls: Mutations known to abolish function (such as E36A) serve as important negative controls for energy-transducing activity assays .

  • Positional controls: When testing the importance of residue position, controls should include mutations that shift the residue to positions on different faces of the transmembrane helix to account for potential interactions with other subunits or lipids .

How can researchers distinguish between primary effects and secondary consequences of NuoK mutations?

Distinguishing primary effects from secondary consequences of NuoK mutations presents a significant challenge. Researchers can employ several strategies to address this issue:

  • Correlation analysis across multiple mutations: By analyzing patterns across various mutations, researchers can identify consistent relationships between specific structural changes and functional outcomes. For example, the observation that Glu-36 can function when relocated to positions 32, 38, 39, and 40 suggests a tolerance for positional shifts along certain faces of the helix .

  • Combined structural and functional analysis: Integrating structural data (where available) with functional measurements helps correlate specific structural perturbations with functional consequences. Although the search results don't provide specific structural data for NuoK, this approach would be valuable for future studies.

  • Comparison with homologous systems: Insights from studies of homologous subunits in other bacteria can help distinguish conserved, likely primary effects from species-specific, potentially secondary effects. The similarity between the site flexibility of Glu-36 in NuoK and MGlu144 in the NuoM subunit suggests a conserved mechanistic feature .

  • Heterodimer studies: The approach used for NQOR, where wild-type/mutant heterodimers were expressed and purified, provides a powerful method for studying subunit interactions and distinguishing between effects on individual subunits versus effects on subunit cooperation. This methodology could potentially be adapted for studying NuoK interactions within the NDH-1 complex .

How does NuoK function in relation to other subunits in the NDH-1 complex?

The function of NuoK must be understood in the context of its interactions with other subunits within the NDH-1 complex. Research findings indicate that NuoK operates in conjunction with NuoA and NuoJ subunits as part of the coupling mechanism of NDH-1 . This relationship suggests that these subunits form a functional module within the larger complex.

The positional flexibility of key glutamate residues in NuoK, particularly the observation that both Glu-36 and Glu-72 can function when relocated to positions one helix turn away from their native locations, suggests that these residues interact with partners that accommodate such movement. These interacting partners may include other subunits of NDH-1 or possibly the lipid environment .

The functional similarities between NuoK and the NuoM subunit, particularly regarding the positional flexibility of essential glutamate residues (Glu-36 in NuoK and MGlu144 in NuoM), suggest common mechanisms in the proton translocation pathway. This observed characteristic was also reported for the essential Asp-61 of the dicyclohexylcarbodiimide-binding subunit of E. coli ATP synthase, potentially indicating a conserved feature of proton-translocating membrane proteins .

What insights do site-directed mutagenesis studies provide about the proton translocation mechanism in NuoK?

Site-directed mutagenesis studies of NuoK have provided several key insights into the proton translocation mechanism:

How might understanding NuoK function contribute to antimicrobial development targeting Burkholderia species?

Understanding the function of NuoK in Burkholderia species could contribute significantly to antimicrobial development through several mechanisms:

  • Targeting essential cellular processes: The NDH-1 complex plays a critical role in bacterial energy metabolism. Given that mutations in key residues of NuoK (such as Glu-36) can almost completely abolish energy-transducing activities, compounds targeting these essential residues could potentially disrupt bacterial energy production .

  • Species-specific targeting: While some aspects of NuoK function are highly conserved across species, the NuoK subunit is described as one of the least conserved subunits of NDH-1. This variability could potentially be exploited to develop antimicrobials with specificity toward Burkholderia species, particularly important given that Burkholderia cepacia complex (Bcc) strains can cause devastating infections in individuals with cystic fibrosis .

  • Rational drug design: The detailed understanding of structure-function relationships in NuoK, particularly the identification of critical residues and their spatial requirements, provides a foundation for rational design of inhibitors that could disrupt NDH-1 function in Burkholderia species .

  • Novel targets beyond traditional antibiotics: In an era of increasing antibiotic resistance, targeting bacterial energy metabolism through NDH-1 and specifically NuoK represents an alternative approach to conventional antibiotic targets such as cell wall synthesis and protein translation .

  • Potential for combination therapies: Inhibitors targeting NuoK could potentially be used in combination with traditional antibiotics or with compounds targeting other aspects of bacterial metabolism, potentially enhancing efficacy against difficult-to-treat Burkholderia infections .

The substantial biosynthetic capacity of Burkholderia species and their ability to produce antimicrobial specialized metabolites, as demonstrated by the finding that 26 of 35 Burkholderia strains exhibited antagonistic activity against pathogenic microbes, further highlights the potential significance of this bacterial genus in antimicrobial research and development .

What heterodimer approaches could advance understanding of NuoK subunit interactions?

Heterodimer approaches, similar to those employed for studying NQOR function, present promising methodologies for advancing understanding of NuoK subunit interactions within the NDH-1 complex. Based on demonstrated techniques, researchers could consider the following approaches:

  • Polyhistidine-tagged wild-type/mutant heterodimers: Following the model used for NQOR, researchers could express a wild-type NuoK subunit tagged with polyhistidine alongside a mutated version (e.g., containing E36A mutation). This approach would enable efficient purification of heterodimeric complexes using nickel nitrilotriacetate column chromatography under nondenaturing conditions .

  • Verification of heterodimer composition: SDS and nondenaturing polyacrylamide gel electrophoresis coupled with immunoblot analysis could confirm the composition and stoichiometry of purified heterodimers .

  • Functional analysis of heterodimeric complexes: Energy-transducing activities of heterodimeric complexes containing one wild-type and one mutant NuoK subunit would provide insights into whether subunits function independently or cooperatively. The observation with NQOR that subunits function independently with two-electron acceptors but dependently with four-electron acceptors provides a model for how such studies might reveal nuanced aspects of subunit cooperation .

Heterodimer ApproachMethodologyExpected Insights
Polyhistidine-tagged wild-type/mutant heterodimersExpress and purify using nickel affinity chromatographyAllows isolation of specific heterodimer combinations
Verification methodsSDS-PAGE, native PAGE, immunoblottingConfirms composition and stoichiometry of purified complexes
Functional analysisEnergy-transducing activity assaysReveals whether subunits function independently or cooperatively

Table 3: Potential heterodimer approaches for studying NuoK subunit interactions

How might genomic and proteomic approaches enhance understanding of NuoK variation across Burkholderia species?

Genomic and proteomic approaches offer powerful tools for characterizing NuoK variation across Burkholderia species and understanding its evolutionary and functional significance:

  • Comparative genomic analysis: Draft genome sequences have been obtained for multiple Burkholderia strains, enabling comprehensive comparative analysis of nuoK gene sequences across species and strains. This approach could identify natural variations in key residues and correlate these with species-specific functional adaptations .

  • Proteogenomic analysis: Integrated analysis of genomic and proteomic data could provide insights into how sequence variations in nuoK translate to structural and functional differences in the expressed protein. This approach has been applied to Burkholderia species, though specific details about nuoK are not provided in the search results .

  • Evolutionary analysis: Phylogenomic approaches applied to nuoK sequences could reveal patterns of conservation and divergence, potentially identifying regions under selective pressure that may correspond to functionally critical domains .

  • Structure prediction and modeling: Computational approaches leveraging genomic data could generate structural models of NuoK variants from different Burkholderia species, potentially revealing how sequence variations impact three-dimensional structure and function.

These approaches would be particularly valuable given that NuoK is described as one of the least conserved subunits of NDH-1, suggesting that species-specific variations may have functional significance .

What strategies could researchers employ to address contradictory findings in nuoK functional studies?

When researchers encounter contradictory findings in nuoK functional studies, several strategic approaches can help resolve discrepancies and advance understanding:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.