Recombinant Burkholderia sp. Probable intracellular septation protein A (Bcep18194_A5211)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Burkholderia sp. Probable Intracellular Septation Protein A (Bcep18194_A5211)

Recombinant Burkholderia sp. Probable intracellular septation protein A (Bcep18194_A5211) is a purified protein derived from Burkholderia species, specifically Burkholderia lata strain 383. This protein is encoded by the gene locus BCEP18194_RS18305 and is associated with intracellular septation, a critical process in bacterial cell division . It is produced recombinantly in Escherichia coli systems with a His-tag for purification and research applications .

Genomic and Evolutionary Context

Bcep18194_A5211 is part of the core genome of the Burkholderia cepacia complex (Bcc), a group of genetically related species with high recombination rates . Key genomic insights include:

  • Locus Tag: BCEP18194_RS18305 (chromosome 1, - strand) .

  • Conservation: Present in all 116 Bcc strains analyzed, indicating evolutionary stability .

  • Recombination Events: Bcc species exhibit frequent inter-species recombination (67.1% of events), which blurs taxonomic boundaries but preserves core genes like Bcep18194_A5211 .

Functional Insights and Hypothetical Roles

While annotated as a "hypothetical protein," its association with septation suggests involvement in cell division. Comparative genomic studies reveal:

  • Positive Selection: 11 core Bcc genes (1.1%) show evidence of positive selection, though Bcep18194_A5211 is not explicitly listed .

  • Recombination: Core genes under recombination pressure are enriched in functional categories like cell wall/membrane biogenesis (COG category M) .

  • Domain Architecture: Encodes a single-domain protein, typical of Bcc core genome simplicity .

Applications in Research

This recombinant protein is commercially available for studies on:

  • Bacterial Cell Division: Mechanistic studies of septation in Burkholderia .

  • Host-Pathogen Interactions: Bcc species infect immunocompromised hosts, making this protein a potential diagnostic or therapeutic target .

  • Evolutionary Analyses: Investigating recombination and selection pressures in Bcc core genes .

Research Challenges and Limitations

  • Functional Ambiguity: Despite structural data, its exact role in septation remains unvalidated .

  • Genetic Diversity: High recombination rates in Bcc complicate strain-specific functional studies .

  • Commercial Availability: Limited suppliers (e.g., Creative BioMart, Anagnostics) restrict accessibility .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize development of the specified tag.
Synonyms
yciB; Bcep18194_A5211; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-176
Protein Length
full length protein
Species
Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Target Names
Bcep18194_A5211
Target Protein Sequence
MKFLFDLFPIILFFAAFKVWGIFTATAVAIVATLAQVAWVAFRHRKVDTMLWVSLGVIVV FGGATLVLHDEKFIQWKPTVLYWLFAIGLLAARYAFGNNLIEKMMGKQLTLPHPVWDKLN VAWALFFAVLGVANLYVVHNFTESQWVNFKLFGTTGAMVVFIILQSLWLTKYLKDE
Uniprot No.

Target Background

Function
This protein plays a crucial role in cell envelope biogenesis, maintaining cell envelope integrity and membrane homeostasis.
Database Links
Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How is the Burkholderia cepacia complex (BCC) related to research on intracellular septation protein A?

The Burkholderia cepacia complex (BCC) is a group of over 20 phenotypically similar but genetically distinct Gram-negative bacteria, including species such as B. cepacia, B. multivorans, B. vietnamiensis, and B. ambifaria . Research on intracellular septation protein A across these species provides valuable insights into conserved cell division mechanisms within this clinically significant bacterial group.

BCC members are opportunistic pathogens that cause severe respiratory infections in immunocompromised patients, particularly those with cystic fibrosis (CF) . According to epidemiological data, BCC infections occur in approximately 2.4% of CF patients, as reported in the 2017 CF Foundation Annual Report . Although this represents a relatively small proportion of infections, BCC infection significantly accelerates lung function deterioration, leading to poor prognosis and high mortality rates .

Understanding the structure and function of essential proteins like intracellular septation protein A across BCC species can:

  • Identify conserved domains as potential targets for broad-spectrum therapeutics

  • Reveal species-specific variations that might explain differences in pathogenicity

  • Contribute to our understanding of bacterial cell division mechanisms in this clinically important group of pathogens

What are the general principles of recombinant protein production relevant to Burkholderia septation proteins?

Recombinant proteins are artificially produced by combining genetic material from different sources . The production of recombinant Burkholderia septation proteins follows several key principles:

  • Gene isolation and vector construction: The gene encoding the intracellular septation protein A is isolated and inserted into a vector containing necessary genetic elements, including promoter sequences that control gene expression .

  • Host organism selection: Appropriate host organisms (bacteria, yeast, or mammalian cells) serve as "factories" for protein production. For Burkholderia proteins, E. coli is often used for initial studies, though expression may be optimized in other systems for specific applications .

  • Protein expression and purification: Following transformation, the host organism synthesizes the protein using its cellular machinery, translating the gene's mRNA into the corresponding protein sequence . Purification typically involves affinity chromatography using tags designed into the recombinant construct.

  • Storage considerations: Recombinant Burkholderia proteins require specific storage conditions. For example, the B. ambifaria septation protein is stored in "Tris-based buffer, 50% glycerol" at -20°C for short-term storage or -80°C for extended storage . Repeated freezing and thawing should be avoided, with working aliquots stored at 4°C for up to one week .

The process must be carefully optimized for each specific protein to ensure proper folding and biological activity, particularly for membrane proteins like intracellular septation protein A, which present unique challenges in heterologous expression systems.

How should researchers design experiments to study recombinant Burkholderia intracellular septation protein A?

Designing rigorous experiments to study recombinant Burkholderia intracellular septation protein A requires careful consideration of statistical principles and methodological approaches:

  • Replication, randomization, and blocking: As outlined in statistical guidelines for experimental design, researchers should ensure proper replication to establish reliability, randomize samples to control for confounding variables, and consider blocking or grouping subjects to reduce variability .

  • Statistical power and sample size calculation: Determine appropriate sample sizes through power analysis to ensure experiments can detect biologically meaningful differences. The required sample size increases with greater power requirements, smaller detectable differences, and larger variance in measurements .

  • Multifactorial design: Consider how multiple experimental factors might interact by using multifactorial designs rather than varying one factor at a time .

  • Expression system selection: Choose an appropriate expression system based on research goals, considering that different host organisms offer various advantages for protein yield, folding, and post-translational modifications .

  • Protein tagging strategy: Select appropriate tags for purification and detection. As noted for similar proteins, "The tag type will be determined during production process" based on specific experimental requirements .

  • Controls and validation: Include appropriate positive and negative controls, and validate protein identity and functionality through multiple complementary techniques.

The experimental design should also consider the membrane-associated nature of intracellular septation protein A, which introduces specific challenges in expression, purification, and functional characterization compared to soluble proteins.

What statistical approaches should be used to determine appropriate sample sizes for experiments with recombinant Burkholderia proteins?

Statistical power analysis is essential for calculating appropriate sample sizes in experiments involving recombinant Burkholderia proteins. The relationship between power, sample size, and detectable difference follows specific mathematical principles:

  • Sample size calculation basics: The relationship between power, sample size, and standardized effect size is interdependent. Sample size increases with higher power requirements, decreases with larger detectable differences, and increases proportionally to variance .

  • For two-sample comparisons: When comparing two groups (e.g., wild-type vs. mutant proteins), the sample size calculation follows this formula:

n = 2( z α + z β) 2(σ/δ) 2

Where:

  • n is the required sample size per group

  • z α is the critical value for significance level α (typically -1.645 for α = 0.05)

  • z β is the critical value for power (typically -0.8416 for 80% power)

  • σ is the standard deviation

  • δ is the detectable difference of interest

  • For paired comparisons: When comparing paired measurements (e.g., before and after treatment), the calculation becomes:

N = ( z α + z β) 2[(σ 1 + σ 2)/δ] 2

Where σ1 and σ2 are the standard deviations of each group .

  • Example calculation: For comparing protein activity between two conditions with σ = 10 units, a detectable difference of interest δ = 5 units, 80% power, and α = 0.05:

n = 2(-1.645 - 0.8416)2(10/5)2 ≈ 50 samples per group

These calculations ensure that experiments are adequately powered to detect meaningful differences while avoiding resource waste from unnecessarily large sample sizes.

What techniques are available for detecting and quantifying expression of recombinant Burkholderia intracellular septation protein A?

Multiple complementary techniques can be employed for detecting and quantifying recombinant Burkholderia intracellular septation protein A expression:

  • Recombinase-aided amplification (RAA) assay: Recently developed for rapid detection of Burkholderia cepacia complex species, this technique targets conserved genes and can be adapted to detect expression of specific proteins like intracellular septation protein A. The method offers high sensitivity and specificity while being quick and easy to perform .

  • Western blotting: This standard technique allows for protein detection using specific antibodies, providing information about protein size and relative abundance. For recombinant proteins with tags, commercial antibodies against the tag can be used if specific antibodies against the protein are unavailable.

  • ELISA-based quantification: As referenced for similar Burkholderia proteins, enzyme-linked immunosorbent assays provide sensitive quantification of protein expression levels . This approach is particularly valuable for standardized detection across multiple samples.

  • Mass spectrometry: For detailed characterization, mass spectrometry can confirm protein identity, detect post-translational modifications, and provide absolute quantification through approaches like selected reaction monitoring (SRM).

  • Fluorescent fusion proteins: Creating fusion proteins with fluorescent tags (e.g., GFP) allows for real-time visualization of protein expression and localization in live cells, particularly valuable for membrane proteins like intracellular septation protein A.

Each method offers different advantages in terms of sensitivity, specificity, and information content, so researchers often employ multiple complementary techniques for comprehensive characterization.

How can structural studies of Burkholderia intracellular septation protein A inform antimicrobial development?

Structural studies of Burkholderia intracellular septation protein A can significantly advance antimicrobial development through several sophisticated approaches:

  • Structure-based drug design: Detailed structural information can identify potential binding pockets and interaction sites for small molecule inhibitors. Since cell division is essential for bacterial survival, compounds that specifically inhibit septation proteins could serve as novel antibiotics against Burkholderia species.

  • Comparative structural analysis across BCC species: Analysis of structural conservation and variation across the Burkholderia cepacia complex can identify:

    • Conserved domains that could serve as targets for broad-spectrum therapeutics

    • Species-specific structural features that might explain differences in pathogenicity

    • Potential resistance mechanisms based on structural variations

  • Protein-protein interaction mapping: Identifying how intracellular septation protein A interacts with other cell division proteins can reveal additional targeting strategies, potentially through disruption of essential protein complexes.

  • Membrane protein-specific considerations: Since intracellular septation protein A is a membrane protein with multiple transmembrane regions , structural studies must account for the membrane environment, potentially using techniques like cryo-electron microscopy or solid-state NMR rather than traditional X-ray crystallography.

The significant clinical impact of BCC infections, particularly in cystic fibrosis patients where infection accelerates lung function deterioration and leads to poor prognosis , underscores the importance of developing novel antimicrobials targeting essential cellular processes like bacterial septation.

What challenges arise when analyzing sequence variations of intracellular septation protein A across different Burkholderia species?

Analyzing sequence variations of intracellular septation protein A across different Burkholderia species presents several complex challenges:

  • Distinguishing functional from neutral variations: Not all sequence differences impact protein function. Identifying which variations affect septation function requires integration of multiple data types, including:

    • Structural information about critical functional domains

    • Evolutionary conservation analysis

    • Experimental validation of variant effects

  • Accounting for strain-specific differences: Even within the same Burkholderia species, strain-specific variations exist. For example, research on the 16S rRNA gene revealed nucleotide positions with multiple subtypes between BCC species: B. cepacia (C), B. multivorans (A or C), B. vietnamiensis (C), and B. ambifaria (C) .

  • Membrane protein-specific considerations: As a membrane protein, intracellular septation protein A contains hydrophobic regions that may show conservation in physiochemical properties rather than exact sequence. The sequence from B. ambifaria reveals multiple predicted transmembrane segments , complicating straightforward sequence comparison.

  • Integrating sequence and functional data: Correlating sequence variations with functional differences requires sophisticated experimental approaches to determine how specific amino acid changes affect:

    • Protein stability and folding

    • Membrane integration

    • Interaction with other septation proteins

    • Function in cell division

How might recombinant Burkholderia septation proteins be utilized in vaccine development research?

Recombinant Burkholderia septation proteins represent potential candidates for vaccine development research through several innovative approaches:

  • Subunit vaccine development: Recombinant proteins can serve as antigens in subunit vaccines, similar to recombinant vaccines for hepatitis B, HPV, and influenza . For Burkholderia septation proteins, this would require:

    • Identifying immunogenic epitopes within the protein

    • Determining if the protein is accessible to the immune system during infection

    • Engineering stable variants that maintain critical epitopes

  • Cross-species protection potential: Analysis of sequence conservation across Burkholderia species could identify highly conserved regions of intracellular septation protein A that might elicit cross-protection against multiple Burkholderia species, addressing the clinical challenge of BCC infections .

  • Adjuvant formulation optimization: Since recombinant proteins often have lower immunogenicity than whole-cell vaccines, research would need to focus on optimal adjuvant formulations to enhance the immune response without excessive reactogenicity.

  • Safety and immunogenicity testing: As proteins involved in essential cellular processes, septation proteins require careful evaluation to ensure vaccine formulations elicit protective immunity without cross-reactivity to human proteins.

While intracellular location may limit direct antibody accessibility, septation proteins could still generate T-cell responses against infected cells, particularly if fragments are presented on MHC molecules. The development of RAA assays for rapid BCC detection demonstrates the feasibility of targeting conserved Burkholderia genes, an approach that could be extended to vaccine development targeting conserved protein antigens.

What are common challenges in expressing and purifying recombinant Burkholderia membrane proteins and how can they be addressed?

Expressing and purifying recombinant Burkholderia membrane proteins like intracellular septation protein A presents several technical challenges:

  • Poor expression and solubility issues:

    • Challenge: Membrane proteins often express poorly and aggregate during heterologous expression

    • Solution: Optimize expression using specialized strains designed for membrane proteins; lower induction temperature (16-20°C); use mild detergents for solubilization; consider fusion tags that enhance solubility

  • Maintaining native conformation:

    • Challenge: Ensuring the purified protein retains its functional structure

    • Solution: Validate protein folding using spectroscopic methods; consider native-like environments during purification (nanodiscs or liposomes); optimize detergent selection

  • Protein instability during storage:

    • Challenge: Maintaining protein stability during long-term storage

    • Solution: As recommended for similar proteins, store in Tris-based buffer with 50% glycerol at -20°C for routine use or -80°C for extended storage; avoid repeated freeze-thaw cycles by preparing working aliquots for storage at 4°C for up to one week

  • Tag selection and interference:

    • Challenge: Tags may affect protein function or structure

    • Solution: Compare different tag positions (N-terminal vs. C-terminal); include tag removal options using specific proteases; the tag type should be determined during the production process based on specific protein characteristics

  • Low yield from purification:

    • Challenge: Obtaining sufficient quantities for downstream applications

    • Solution: Scale up culture volume; optimize induction conditions; consider alternative expression systems like yeast or insect cells for improved yield of membrane proteins

These challenges require systematic optimization for each specific protein, with careful documentation of conditions that yield functionally active protein.

How can researchers address inconsistent results when studying recombinant Burkholderia proteins?

When facing inconsistent results with recombinant Burkholderia proteins, researchers should implement a systematic troubleshooting approach:

  • Statistical considerations for experimental design:

    • Ensure adequate sample size based on power analysis as described in statistical guidelines

    • Implement proper randomization and blinding procedures to minimize bias

    • Consider the following formula for paired comparison sample size: N = ( z α + z β)²[(σ₁ + σ₂)/δ]²

    • Document and control for sources of variation in experimental conditions

  • Protein quality assessment:

    • Verify protein integrity through SDS-PAGE, mass spectrometry, and western blotting

    • Confirm batch-to-batch consistency in purity and concentration

    • Validate protein functionality through activity assays before complex experiments

  • Protocol standardization:

    • Develop detailed standard operating procedures (SOPs) for all experimental steps

    • Standardize buffer components, including precise pH and ionic strength

    • Control for lot-to-lot variations in reagents and consumables

  • Storage and handling optimization:

    • Follow recommended storage conditions (Tris-based buffer, 50% glycerol, at -20°C or -80°C for extended storage)

    • Avoid repeated freeze-thaw cycles by preparing single-use aliquots

    • Document storage duration for each sample used in experiments

  • Systematic variation of experimental parameters:

    • Create a matrix of experimental conditions to identify critical parameters

    • Test multiple buffer conditions, temperatures, and incubation times

    • Analyze results quantitatively to identify optimal conditions and sources of variability

By implementing these strategies, researchers can identify and control sources of variability, leading to more consistent and reproducible results when working with recombinant Burkholderia proteins.

What strategies can be employed to optimize detection of low-abundance Burkholderia septation proteins in complex samples?

Detecting low-abundance Burkholderia septation proteins in complex samples requires specialized approaches to enhance sensitivity and specificity:

  • Enrichment strategies:

    • Membrane fractionation to concentrate membrane proteins

    • Immunoprecipitation using antibodies against the protein or affinity tags

    • Size-based enrichment methods like ultrafiltration or size exclusion chromatography

  • Advanced detection technologies:

    • Recombinase-aided amplification (RAA) assays can be adapted for protein detection through aptamer-based approaches, offering rapid and sensitive detection as demonstrated for BCC detection

    • Selected reaction monitoring (SRM) mass spectrometry for targeted detection of specific peptides from the protein of interest

    • Proximity ligation assays (PLA) for in situ detection with high sensitivity

  • Signal amplification methods:

    • Enzyme-linked immunosorbent assays (ELISA) with enhanced chemiluminescence detection

    • Tyramide signal amplification for immunohistochemistry applications

    • Digital ELISA platforms (e.g., Simoa) for single-molecule detection

  • Optimized sample preparation:

    • Careful selection of lysis buffers to efficiently extract membrane proteins

    • Use of protease inhibitors to prevent degradation during preparation

    • Removal of abundant proteins using depletion strategies

  • Computational approaches:

    • Machine learning algorithms to distinguish signal from background noise

    • Integration of multiple data types for confident protein identification

    • Specialized software for analysis of membrane protein mass spectrometry data

The detection sensitivity can be further enhanced by choosing the appropriate combination of these methods based on the specific experimental context and available resources.

What statistical methods are appropriate for analyzing data from experiments with recombinant Burkholderia proteins?

Selecting appropriate statistical methods for analyzing data from experiments with recombinant Burkholderia proteins depends on the experimental design and data characteristics:

  • For comparing two experimental conditions:

    • Independent samples t-test for unpaired comparisons with normally distributed data

    • Paired t-test for before-after or matched-sample designs

    • Non-parametric alternatives (Mann-Whitney U or Wilcoxon signed-rank) for non-normally distributed data

    • Sample size calculation using the formula: n = 2( z α + z β)²(σ/δ)² for adequate statistical power

  • For multiple experimental conditions:

    • One-way ANOVA followed by appropriate post-hoc tests for more than two groups

    • Repeated measures ANOVA for time-course experiments

    • Mixed-effects models for complex designs with multiple factors

  • For dose-response relationships:

    • Regression analysis to characterize the relationship between protein concentration and response

    • Non-linear curve fitting for enzyme kinetics or binding studies

    • EC50/IC50 determination for functional characterization

  • For variability assessment:

    • Coefficient of variation (CV) calculation to assess reproducibility

    • Bland-Altman plots for method comparison studies

    • Analysis of sources of variation using components of variance analysis

The statistical approach should be determined during experimental design rather than after data collection, ensuring appropriate power and sample size as outlined in statistical guidelines for experimental design in visual science research .

How can researchers distinguish between protein isoforms or closely related septation proteins from different Burkholderia species?

Distinguishing between protein isoforms or closely related septation proteins from different Burkholderia species requires integrated analytical approaches:

  • High-resolution protein separation:

    • 2D electrophoresis to separate proteins based on both molecular weight and isoelectric point

    • High-performance liquid chromatography (HPLC) with various stationary phases

    • Capillary electrophoresis for highly sensitive separation

  • Mass spectrometry-based identification:

    • Bottom-up proteomics to identify species-specific peptides

    • Top-down proteomics for intact protein characterization

    • Targeted approaches like parallel reaction monitoring (PRM) focusing on unique peptides

    • Analysis of species-specific variations in peptide mass fingerprints

  • Sequence-specific antibodies:

    • Development of antibodies targeting unique epitopes in each protein variant

    • Epitope mapping to confirm antibody specificity

    • Western blotting with isoform-specific antibodies

  • Genetic approaches:

    • PCR amplification with species-specific primers, similar to the RAA assay developed for BCC detection targeting the 16S rRNA gene

    • DNA sequencing to confirm the specific variant being expressed

    • Analysis of nucleotide positions with multiple subtypes between BCC species, as identified in Figure 1 of the RAA assay development

  • Functional characterization:

    • Comparison of biochemical properties (activity, substrate specificity)

    • Analysis of protein-protein interaction profiles

    • Localization patterns within bacterial cells

The combined application of these approaches can reliably distinguish between closely related septation proteins from different Burkholderia species, facilitating accurate interpretation of experimental results.

What are the most promising future directions for research on Burkholderia intracellular septation protein A?

Research on Burkholderia intracellular septation protein A shows several promising future directions with significant potential impact:

  • Antimicrobial development: As an essential protein involved in bacterial cell division, intracellular septation protein A represents a potential target for novel antibiotics. Structure-based drug design approaches could identify inhibitors that specifically target this protein, addressing the significant clinical need for new treatments against BCC infections, which affect approximately 2.4% of cystic fibrosis patients and lead to poor prognosis and high mortality .

  • Structural biology advances: Determining high-resolution structures of intracellular septation protein A from multiple Burkholderia species could reveal conserved functional domains and species-specific variations. These insights would enhance our understanding of bacterial cell division mechanisms and facilitate comparative analyses across the BCC, which includes over 20 genetically distinct bacteria .

  • Diagnostic applications: Building on the success of rapid detection methods like the recombinase-aided amplification (RAA) assay for BCC , research could develop protein-based diagnostic tools targeting intracellular septation protein A. Such approaches could provide rapid identification of specific Burkholderia species in clinical samples, enabling more targeted treatment strategies.

  • Systems biology integration: Investigating how intracellular septation protein A interacts with other components of the bacterial cell division machinery could provide insights into the complex regulatory networks controlling bacterial reproduction. This systems-level understanding could identify additional intervention points for therapeutic development.

  • Evolutionary biology perspectives: Comparative analysis of septation proteins across diverse bacterial species could illuminate the evolutionary history of cell division mechanisms and identify conserved features that might serve as broad-spectrum antimicrobial targets.

These research directions represent opportunities to translate basic scientific knowledge about Burkholderia intracellular septation protein A into practical applications for addressing the significant clinical challenges posed by BCC infections.

How can researchers effectively integrate multiple analytical techniques when studying recombinant Burkholderia proteins?

Effective integration of multiple analytical techniques when studying recombinant Burkholderia proteins requires strategic planning and methodological coordination:

  • Complementary technique selection: Choose techniques that provide different but complementary information about the protein:

    • Structural techniques (X-ray crystallography, NMR, cryo-EM)

    • Functional assays (enzyme activity, binding studies)

    • Interaction studies (co-immunoprecipitation, yeast two-hybrid)

    • Localization methods (fluorescence microscopy, subcellular fractionation)

  • Sequential analytical workflow:

    • Begin with protein quality assessment (SDS-PAGE, mass spectrometry)

    • Proceed to structural characterization (circular dichroism, fluorescence spectroscopy)

    • Follow with functional studies (activity assays, binding studies)

    • Conclude with interaction and localization studies (co-IP, microscopy)

  • Data integration strategies:

    • Develop computational frameworks to integrate diverse data types

    • Use statistical models to identify consistent patterns across multiple datasets

    • Apply machine learning approaches to predict protein properties from combined data

  • Collaborative expertise: Form interdisciplinary teams with expertise in:

    • Protein biochemistry and purification

    • Structural biology methods

    • Cellular and molecular biology techniques

    • Computational analysis and modeling

    • Statistical design of experiments

  • Standardized sample preparation:

    • Ensure consistent protein production and purification

    • Document and control storage conditions (e.g., Tris-based buffer, 50% glycerol at -20°C or -80°C)

    • Prepare multiple aliquots from the same preparation for cross-technique comparison

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.