Recombinant Burkholderia sp. Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Burkholderia sp. Prolipoprotein Diacylglyceryl Transferase (Lgt)

Recombinant Burkholderia sp. prolipoprotein diacylglyceryl transferase (Lgt) is a membrane-bound enzyme critical for bacterial lipoprotein biosynthesis. Lgt catalyzes the first step in post-translational lipid modification by transferring a diacylglyceryl group from phosphatidylglycerol (PG) to the conserved cysteine residue in the lipobox motif of prolipoproteins . This modification is essential for anchoring lipoproteins to the bacterial membrane, impacting membrane integrity, virulence, and antibiotic resistance . Recombinant forms of Lgt are engineered for structural, functional, and therapeutic studies, leveraging heterologous expression systems like E. coli or yeast .

Primary Structure and Domains

The Burkholderia Lgt enzyme shares structural homology with E. coli Lgt, featuring:

  • Seven transmembrane helices forming a central cavity for substrate binding .

  • Two periplasmic arms (arm-1 and arm-2) involved in substrate recognition and catalysis .

  • A conserved signature motif (e.g., residues R143, E151, R239) critical for PG binding and transacylation activity .

Table 2: Recombinant Lgt Production Parameters

ParameterDetails
Expression RegionFull-length (residues 1–296 in B. pseudomallei)
Purity≥85% (SDS-PAGE verified)
Activity AssaysGFP-based in vitro assays, complementation of lgt-knockout strains

Antibiotic Development

  • Inhibitor Screening: Lgt is a target for novel antibiotics. Inhibitors like palmitic acid block PG binding, disrupting lipoprotein maturation .

  • Bactericidal Effects: Lgt depletion in E. coli and Acinetobacter baumannii causes outer membrane permeabilization and cell death .

Agricultural Biotechnology

  • Plant Growth Promotion: Burkholderia spp. Lgt supports rhizosphere colonization, enhancing plant growth via auxin synthesis and stress tolerance .

Table 3: Key Research Findings

Study FocusOutcomeSource
Structural AnalysisSolved crystal structures (1.6–1.9 Å) with PG and inhibitors
MutagenesisR143A/R239A mutants abolish enzymatic activity
Inhibitor EfficacyNovel Lgt inhibitors show bactericidal activity against wild-type strains
Agricultural PotentialBurkholderia Lgt enhances corn seedling biomass by 15–20%

Comparative Analysis with Homologs

Table 4: Lgt Homologs Across Bacterial Species

SpeciesKey Features
Burkholderia pseudomallei296 residues; Uniprot Q3JV10; essential for virulence
Escherichia coli291 residues; R143/R239 critical for catalysis
Acinetobacter baumanniiTargeted by broad-spectrum Lgt inhibitors

Challenges and Future Directions

  • Resistance Mechanisms: No on-target resistance reported yet, but long-term studies are needed .

  • Structural Optimization: Engineering thermostable variants for industrial applications .

  • Therapeutic Potential: Combining Lgt inhibitors with existing antibiotics to overcome permeability barriers .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
lgt; Bcep18194_A5791; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-296
Protein Length
full length protein
Species
Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Target Names
lgt
Target Protein Sequence
MIIHPNFDPVAIHLGPLAVRWYGLMYLVGFIAAIVVGRIRLKLPHVAAQGWTAKDIDDMM FYGVLGTVLGGRLGYVLFYKADFYFSHPLDVFKVWEGGMSFHGGFLGVTLAMMLFAWQRK RHWLQVTDFVAPMVPTGLAAGRLGNFINGELWGRVTDPSAPWAMLFPGAMRDDAAWLPKH PELVEKWHLADVFMQYQMLPRHPSQLYEIALEGIVLFFALFLFARKSRPMGAVSALFLIG YGLARFTVEFAREPDDFLGLLALGLSMGQWLSLPMILAGVALMVWAYRRRAANAAA
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the formation of mature lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is prolipoprotein diacylglyceryl transferase (Lgt) and what role does it play in Burkholderia?

Prolipoprotein diacylglyceryl transferase (Lgt) is an integral membrane enzyme that catalyzes the transfer of a diacylglyceryl moiety from phosphatidylglycerol to the sulfhydryl group of the invariant cysteine residue in the "lipobox" motif of prolipoproteins . This modification represents the first step in lipoprotein biosynthesis, a process essential for bacterial survival. In Burkholderia species, as in other bacteria, lipoproteins perform diverse and critical functions including maintenance of cell envelope architecture, insertion and stabilization of outer membrane proteins, nutrient uptake, transport, adhesion, invasion, and virulence .

The importance of Lgt in Burkholderia can be inferred from studies showing that deletion of the lgt gene is lethal to most Gram-negative bacteria . The proper functioning of Lgt is crucial for Burkholderia's ecological versatility, enabling these bacteria to adapt to diverse niches ranging from soil and water to plant rhizospheres and human hosts . Burkholderia species are found in various terrestrial and aquatic environments, forming associations with eukaryotic hosts including humans, animals, plants, and fungi .

How does the lipoprotein biosynthesis pathway function in Burkholderia sp.?

The lipoprotein biosynthesis pathway in Burkholderia follows the general three-step post-translational modification process observed in Gram-negative bacteria . The pathway begins with the recognition of a prolipoprotein containing a signal peptide with a conserved lipobox motif. Lgt catalyzes the first step by transferring a diacylglyceryl group from phosphatidylglycerol to the cysteine residue within this lipobox . This modification anchors the prolipoprotein to the membrane.

Following Lgt-mediated diacylglyceryl modification, two additional enzymes complete the maturation process: lipoprotein signal peptidase (LspA) cleaves the signal peptide, and lipoprotein N-acyltransferase (Lnt) adds a third fatty acid to the amino group of the N-terminal cysteine. Crystal structures of E. coli Lgt in complex with phosphatidylglycerol and the inhibitor palmitic acid have provided insights into the mechanism of this enzyme . These structures reveal the presence of two binding sites and support a lateral entry and exit mechanism for substrates and products relative to the lipid bilayer .

The mature lipoproteins are then trafficked to their final destinations in the bacterial cell envelope, where they perform their respective functions. In Burkholderia species, these lipoproteins contribute to the bacterium's ability to adapt to diverse ecological niches and, in some cases, cause disease in susceptible hosts .

What experimental methods are used to study recombinant Burkholderia Lgt?

Several experimental approaches are employed to study recombinant Burkholderia Lgt:

  • Gene Knockout and Complementation Studies: Genetic techniques including traditional homologous recombination, Red/ET recombination, and Flp-FRT recombination systems have been applied in various Burkholderia strains to generate gene knockouts . Complementation experiments with different Lgt variants can reveal critical residues essential for enzyme function, such as Arg143 and Arg239 identified in E. coli Lgt .

  • Promoter Engineering: RNA-Seq analysis has been used to identify endogenous strong promoters in Burkholderia sp. that can drive expression of recombinant proteins . For example, in Burkholderia sp. JP2-270, analysis of transcriptomic data from three different developmental periods led to the identification of 50 endogenous promoters with high transcriptional activity . The promoter of a hypothetical protein (Php) was found to be significantly expressed in all three periods and required a sequence length of 173 bp for optimal activity .

  • Fluorescence-Based Assays: GFP-based in vitro assays have been employed to correlate Lgt activities with structural observations . Fluorescent reporter systems can also be used to evaluate promoter strength for recombinant expression .

  • Heterologous Expression: Various systems have been developed for heterologous expression of Burkholderia proteins, including expression in E. coli and Pseudomonas aeruginosa . These systems can be adapted for recombinant Lgt production.

  • RT-qPCR Analysis: This technique has been used to quantify gene expression levels in Burkholderia, providing a tool to optimize recombinant protein production strategies .

What structural features are important for Lgt function?

The structural features crucial for Lgt function can be inferred from studies of E. coli Lgt, which likely shares conserved features with Burkholderia Lgt. Crystal structures at high resolution (1.9 Å and 1.6 Å) have revealed several key structural elements :

  • Dual Binding Sites: The presence of two binding sites, one for phosphatidylglycerol and another potentially for the prolipoprotein substrate . This dual-binding architecture is essential for bringing the two substrates into proximity for the transfer reaction.

  • Critical Arginine Residues: Complementation studies with Lgt mutants have identified Arg143 and Arg239 as residues essential for diacylglyceryl transfer . These positively charged residues likely interact with the negatively charged phosphate group of the phosphatidylglycerol substrate.

  • Membrane Topology: The enzyme's architecture facilitates lateral entry and exit of substrates and products relative to the lipid bilayer . This topology is critical for accessing both the membrane-embedded phosphatidylglycerol and the partially membrane-associated prolipoprotein substrate.

  • Catalytic Site: The arrangement of specific amino acids that facilitate the transfer of the diacylglyceryl moiety from phosphatidylglycerol to the cysteine residue of the prolipoprotein.

Understanding these structural features is essential for elucidating the mechanism of Lgt and designing potential inhibitors that could serve as novel antimicrobials against pathogenic Burkholderia species.

How can promoter engineering improve recombinant Lgt expression in Burkholderia?

Promoter engineering represents a powerful approach for optimizing recombinant Lgt expression in Burkholderia species. The identification and characterization of endogenous strong promoters can significantly enhance gene expression levels, as demonstrated in recent studies with Burkholderia sp. JP2-270 . RNA-Seq analysis of this strain at three different developmental periods led to the screening of 50 endogenous promoters with high transcriptional activity . Nine of these promoters were verified to produce obvious fluorescent signals when tested with a reporter gene .

Particularly noteworthy was the promoter of a hypothetical protein (Php), which exhibited significant expression across all three developmental periods . When this promoter was used to overexpress pyrrolnitrin (PRN) biosynthesis genes in Burkholderia sp. JP2-270, gene expression levels increased by 40-80 times compared to the wild type . This substantial enhancement in expression demonstrates the potential of optimized endogenous promoters for recombinant protein production.

The length of the promoter sequence also plays a crucial role in its activity. For the Php promoter, studies revealed that a sequence length of 173 bp was necessary for optimal activity . This finding highlights the importance of defining the minimal functional promoter region when designing expression systems. Similar approaches could be applied to optimize the expression of recombinant Lgt in various Burkholderia species, potentially yielding sufficient quantities of the enzyme for structural and functional studies.

What techniques can be used to study Lgt-substrate interactions?

Understanding Lgt-substrate interactions is essential for elucidating the enzyme's mechanism and developing potential inhibitors. Several techniques can be employed to investigate these interactions:

  • Crystallography: X-ray crystallography has been successfully used to determine the structure of E. coli Lgt in complex with its substrate phosphatidylglycerol and the inhibitor palmitic acid at resolutions of 1.9 Å and 1.6 Å, respectively . Similar approaches could be applied to Burkholderia Lgt to visualize enzyme-substrate complexes.

  • Site-Directed Mutagenesis: This technique can identify critical residues involved in substrate binding and catalysis. Complementation studies with different Lgt mutants have already revealed that Arg143 and Arg239 are essential for diacylglyceryl transfer in E. coli Lgt . Similar mutagenesis studies could be conducted with Burkholderia Lgt to identify species-specific determinants of substrate specificity.

  • Binding Assays: Various biochemical and biophysical methods can be used to characterize Lgt-substrate interactions, including isothermal titration calorimetry, surface plasmon resonance, and microscale thermophoresis.

  • GFP-Based In Vitro Assays: These assays have been used to correlate Lgt activities with structural observations . They can be adapted to study how mutations or conditions affect substrate binding and catalysis.

  • Molecular Dynamics Simulations: Computational approaches can provide insights into the dynamics of Lgt-substrate interactions, complementing experimental data from structural studies.

By combining these techniques, researchers can develop a comprehensive understanding of how Burkholderia Lgt recognizes and processes its substrates, potentially revealing unique features that could be exploited for species-specific inhibitor design.

How can recombinant Lgt be used to study lipoprotein function in Burkholderia?

Recombinant Lgt provides a valuable tool for investigating lipoprotein function in Burkholderia species, which perform a wide range of biological roles:

  • Lipoprotein Modification Studies: Purified recombinant Lgt can be used to modify specific prolipoproteins in vitro, allowing researchers to study the effects of lipidation on protein structure, localization, and function. This approach can be particularly useful for proteins that are difficult to express in their native lipidated form.

  • Identification of Lipoprotein Repertoire: By combining bioinformatics predictions of lipobox-containing proteins with in vitro modification using recombinant Lgt, researchers can validate putative lipoproteins in Burkholderia genomes. This approach can help define the complete lipoprotein repertoire of different Burkholderia species.

  • Structure-Function Studies: Controlled lipidation of proteins using recombinant Lgt can facilitate studies on how lipid modification affects protein structure and function. This is particularly relevant for understanding the roles of lipoproteins in membrane organization, signaling, and host-pathogen interactions.

  • Lipoprotein-Host Interaction Studies: Recombinant Lgt can be used to generate defined lipoproteins for studying their interactions with host receptors and immune components. This is especially important for understanding the virulence mechanisms of pathogenic Burkholderia species, which include opportunistic human pathogens that can cause serious infections .

  • Development of Lipoprotein-Based Vaccines: Recombinant Lgt-mediated lipidation of antigens can enhance their immunogenicity, potentially leading to the development of effective vaccines against pathogenic Burkholderia species.

What role does Lgt play in the virulence of pathogenic Burkholderia species?

Lgt likely plays a significant role in the virulence of pathogenic Burkholderia species, particularly those belonging to the Burkholderia cepacia complex (Bcc) and other pathogenic members like B. pseudomallei and B. mallei . These bacteria can cause severe infections in humans, with Bcc being particularly problematic for cystic fibrosis patients . B. pseudomallei and B. mallei, the causative agents of melioidosis and glanders respectively, are listed as potential bioweapons by the Center for Disease Control .

The contribution of Lgt to virulence stems from its essential role in lipoprotein biosynthesis. In pathogenic Burkholderia, lipoproteins may contribute to virulence through several mechanisms:

  • Maintenance of Membrane Integrity: Properly modified lipoproteins are crucial for maintaining cell envelope architecture . This integrity is essential for survival within host environments and resistance to host defense mechanisms.

  • Nutrient Acquisition: Many bacterial lipoproteins function in nutrient uptake systems . In the nutrient-limited environment of a host, these functions become critical for bacterial survival and proliferation.

  • Host Adhesion and Invasion: Some lipoproteins may directly mediate attachment to host cells or tissues, facilitating colonization and invasion . This is particularly relevant for Burkholderia species that can establish intracellular infections.

  • Immune Modulation: Bacterial lipoproteins can interact with host pattern recognition receptors like Toll-like receptors, potentially modulating immune responses to favor bacterial survival.

  • Transport of Virulence Factors: Lipoproteins may be involved in secretion systems that deliver virulence factors to host cells.

Understanding the specific roles of Lgt and its lipoprotein products in Burkholderia pathogenesis could identify potential targets for therapeutic intervention against these often difficult-to-treat pathogens.

How does Lgt function contribute to Burkholderia's ecological versatility?

The Lgt enzyme plays a fundamental role in enabling the remarkable ecological versatility of Burkholderia species. These bacteria inhabit diverse niches ranging from soil and water to plant rhizospheres and associations with various hosts including humans, animals, plants, and fungi . The proper functioning of Lgt ensures the correct processing of lipoproteins that mediate interactions with these diverse environments.

In the context of plant associations, Burkholderia species can establish both beneficial and pathogenic relationships. Some species promote plant growth and protect plants from pests, while others cause diseases like rice rot . For instance, Burkholderia ambifaria and Burkholderia caribensis are presumably diazotrophic strains that promote growth of grain crops, while Burkholderia rinojensis exhibits activity against arthropod pests, making it a potential alternative to chemical pesticides . These diverse ecological interactions likely depend on specific lipoproteins that mediate attachment to plant surfaces, nutrient acquisition, and other functions necessary for establishing successful plant-microbe relationships.

Additionally, the complex three-player associations involving Burkholderia, fungi, and plants highlight the sophisticated ecological networks these bacteria participate in. An interesting example is the association between a rice pathogenic fungus (Rhizopus sp.) and a Burkholderia species that lives inside the fungus as an endosymbiont, producing the polyketide precursor of rhizoxin, a phytotoxin that affects rice cells . Such intricate relationships may involve lipoproteins that facilitate bacterial-fungal interactions, further emphasizing the importance of Lgt function in Burkholderia's ecological adaptability.

How does Lgt research connect to natural product discovery in Burkholderia?

Lgt research intersects with natural product discovery in Burkholderia in several significant ways. Burkholderia species are now recognized as the second largest source of natural product bacteria after Actinomyces and produce many valuable secondary metabolites . The large, multi-replicon genomes of Burkholderia encode a plethora of natural products with potential therapeutic relevance and biotechnological applications .

The connection between Lgt function and natural product biosynthesis may occur at multiple levels:

  • Regulatory Interactions: The lipoprotein biosynthesis pathway may share regulatory elements with pathways for secondary metabolite production. Understanding Lgt expression and regulation could provide insights into coordinated control of multiple biosynthetic processes.

  • Cell Envelope Integrity: Proper lipoprotein processing by Lgt ensures membrane integrity, which is essential for normal cellular physiology, including secondary metabolite production. Disruptions in Lgt function could indirectly affect natural product biosynthesis by altering cellular homeostasis.

  • Secretion and Transport: Some lipoproteins may be involved in the export or transport of natural products or their precursors. Studying Lgt-dependent lipoproteins could reveal novel components of biosynthetic and transport machinery.

  • Genetic Engineering Approaches: Similar genetic tools can be applied to study both Lgt function and natural product biosynthesis. For example, the promoter engineering strategies used to enhance pyrrolnitrin production in Burkholderia sp. JP2-270 could be adapted for recombinant Lgt expression . The endogenous strong promoters identified through RNA-Seq analysis have been demonstrated to successfully increase gene expression levels by 40-80 times when used to overexpress biosynthetic genes .

What analytical techniques are most effective for studying recombinant Lgt activity?

Several analytical techniques can be effectively employed to study the activity of recombinant Burkholderia Lgt:

  • Fluorescence-Based Assays: GFP-based in vitro assays have been successfully used to correlate Lgt activities with structural observations . These assays provide a convenient and sensitive method for monitoring enzyme activity and can be adapted for high-throughput screening applications.

  • RT-qPCR Analysis: This technique has been employed to verify gene expression levels after promoter engineering in Burkholderia . For recombinant Lgt studies, RT-qPCR can confirm successful expression of the enzyme and quantify transcript levels under various conditions.

  • Complementation Assays: Functional assays based on the ability of recombinant Lgt variants to complement lgt-knockout cells can provide insights into structure-function relationships . These assays have revealed critical residues such as Arg143 and Arg239 that are essential for diacylglyceryl transfer in E. coli Lgt .

  • Mass Spectrometry: This technique can be used to directly detect and characterize lipid modifications on substrate proteins. Mass spectrometry provides high sensitivity and specificity for confirming Lgt-catalyzed transfers and identifying the precise sites of modification.

  • Crystallography and Structural Analysis: High-resolution structural analysis has provided valuable insights into Lgt function in E. coli . Similar approaches could be applied to Burkholderia Lgt to reveal species-specific structural features.

  • In Vivo Fluorescent Reporters: Fluorescent reporter systems have been used to evaluate promoter activity in Burkholderia . Similar approaches could be adapted to monitor Lgt activity or expression in living cells.

The choice of analytical technique depends on the specific aspects of Lgt function being investigated, whether it's basic enzymatic activity, substrate specificity, structure-function relationships, or regulation of expression.

What are the challenges in expressing and purifying recombinant Burkholderia Lgt?

Expressing and purifying recombinant Burkholderia Lgt presents several challenges that researchers must address:

  • Membrane Protein Expression: As an integral membrane enzyme, Lgt is inherently difficult to express in heterologous systems. Membrane proteins often fold improperly when overexpressed, leading to aggregation and formation of inclusion bodies. Optimizing expression conditions such as temperature, inducer concentration, and host strain is critical for obtaining properly folded protein.

  • Selection of Expression System: While E. coli is commonly used for heterologous protein expression, it may not provide the optimal membrane environment for Burkholderia Lgt. Alternative expression hosts, including Burkholderia itself, might be more suitable. The identification of strong endogenous promoters in Burkholderia sp. offers opportunities for homologous expression . The promoter of a hypothetical protein (Php) has been shown to significantly increase gene expression levels in Burkholderia sp. JP2-270 .

  • Protein Solubilization: Extracting Lgt from membranes requires careful selection of detergents that maintain protein structure and activity. Different detergents may vary in their ability to solubilize the protein while preserving its native conformation and enzymatic function.

  • Purification Strategy: Developing an effective purification protocol for Lgt requires balancing yield, purity, and activity. Affinity tags can facilitate purification but may affect protein function if not properly positioned or removed. Multi-step purification procedures are often necessary to achieve high purity while maintaining activity.

  • Stability Concerns: Membrane proteins like Lgt are often unstable once removed from their native lipid environment. Stabilizing additives, appropriate buffer conditions, and reconstitution into lipid bilayers or nanodiscs may be necessary to maintain activity during and after purification.

  • Activity Assessment: Developing reliable assays to confirm that the purified recombinant Lgt retains its enzymatic activity is essential. This may involve fluorescence-based assays similar to those used with E. coli Lgt or complementation studies in lgt-knockout cells.

How can recombinant Lgt be used to develop antimicrobials against pathogenic Burkholderia?

Recombinant Lgt offers several avenues for developing antimicrobials against pathogenic Burkholderia species:

  • Target-Based Drug Discovery: Purified recombinant Lgt can be used in high-throughput screening assays to identify potential inhibitors. The crystal structures of E. coli Lgt complexed with phosphatidylglycerol and palmitic acid provide templates for structure-based drug design approaches . Similar structures of Burkholderia Lgt would enable the design of species-specific inhibitors.

  • Mechanism-Based Inhibitor Design: Understanding the catalytic mechanism of Lgt through studies with the recombinant enzyme can inform the design of mechanism-based inhibitors. The identification of critical residues like Arg143 and Arg239 in E. coli Lgt suggests potential sites for targeted inhibition .

  • Validation of Lgt as an Antimicrobial Target: Recombinant Lgt can be used to confirm the essentiality of this enzyme in pathogenic Burkholderia species. Complementation studies with various Lgt mutants can identify which aspects of enzyme function are most critical for bacterial survival .

  • Substrate Analog Development: Knowledge of how Lgt interacts with its substrates can guide the development of substrate analogs that competitively inhibit the enzyme. The inhibition of E. coli Lgt by palmitic acid suggests that fatty acid-based compounds might serve as starting points for inhibitor development .

  • Assay Development for Drug Screening: Fluorescence-based assays used to correlate Lgt activities with structural observations could be adapted for screening compound libraries for potential inhibitors . These assays could be tailored to detect inhibition of Burkholderia Lgt specifically.

Given that deletion of the lgt gene is lethal to most Gram-negative bacteria, Lgt inhibitors could serve as broad-spectrum antibiotics or be tailored for selective activity against Burkholderia species that are particularly problematic, such as those in the Burkholderia cepacia complex that affect cystic fibrosis patients .

What biotechnological applications could utilize recombinant Burkholderia Lgt?

Recombinant Burkholderia Lgt has significant potential for various biotechnological applications:

  • Protein Engineering and Display: Lgt can be used to create lipid-anchored proteins for surface display on cells or synthetic membranes. This approach could be valuable for developing whole-cell biocatalysts, biosensors, or cell-surface antigen presentation systems.

  • Vaccine Development: Lipoproteins are often highly immunogenic, and Lgt-mediated lipidation of antigens could enhance vaccine efficacy. Recombinant Lgt could be used to create lipidated antigens from Burkholderia or other pathogens for vaccine formulations.

  • Biosensor Development: Lipid-anchored recognition elements or reporter proteins created using recombinant Lgt could be incorporated into biosensor platforms for environmental monitoring, medical diagnostics, or food safety applications.

  • Enzyme Immobilization: Lgt-mediated lipidation provides a gentle method for anchoring enzymes to membranes or lipid-coated surfaces without chemical modification that might compromise activity. This could be valuable for creating reusable biocatalysts or enzyme cascade systems.

  • Drug Delivery Systems: Lipoproteins created using recombinant Lgt could be incorporated into liposomes or other lipid-based drug delivery vehicles, potentially enhancing targeting or controlled release properties.

  • Synthetic Biology Applications: In synthetic biology approaches, Lgt could be used to create artificial membrane systems with defined lipoprotein components, contributing to the development of minimal cells or specialized membrane-bound reaction compartments.

The ability to produce specific lipid-modified proteins using recombinant Lgt provides a versatile tool for various biotechnological applications that benefit from membrane association or lipid anchoring of proteins.

How can genomic analysis enhance our understanding of Lgt function across Burkholderia species?

Genomic analysis offers powerful approaches to enhance our understanding of Lgt function across the diverse Burkholderia genus:

These genomic approaches can significantly enhance our understanding of how Lgt function has evolved across the Burkholderia genus and how it contributes to the remarkable ecological and metabolic diversity of these bacteria.

What future research directions are most promising for Burkholderia Lgt studies?

Several promising research directions emerge for future studies of Burkholderia Lgt:

  • Structural Characterization: Determining high-resolution structures of Burkholderia Lgt, similar to those achieved for E. coli Lgt , would provide valuable insights into species-specific features. These structures could reveal unique aspects of substrate binding, catalytic mechanism, or membrane association that might be exploited for selective inhibitor design.

  • In Vivo Dynamics: Investigating the in vivo dynamics of Lgt function using advanced imaging techniques or reporter systems would enhance our understanding of how this enzyme operates within the native cellular context. This approach could reveal regulatory mechanisms, interaction partners, or localization patterns that influence Lgt activity.

  • System-Level Integration: Exploring how Lgt function integrates with other cellular processes, including membrane biogenesis, protein secretion, and stress responses, would provide a more comprehensive understanding of its role in Burkholderia physiology. This could be achieved through multi-omics approaches combining genomics, transcriptomics, proteomics, and metabolomics.

  • Host-Pathogen Interactions: Investigating how Lgt-dependent lipoproteins influence interactions between pathogenic Burkholderia species and their hosts could reveal new aspects of virulence mechanisms. This research direction is particularly relevant for species in the Burkholderia cepacia complex that affect cystic fibrosis patients and for B. pseudomallei and B. mallei, which cause serious human diseases .

  • Therapeutic Applications: Developing Lgt inhibitors as potential antimicrobials against pathogenic Burkholderia represents a promising research direction. The essentiality of lgt in most Gram-negative bacteria makes it an attractive target , and structure-based approaches could lead to selective inhibitors with therapeutic potential.

  • Biotechnological Exploitation: Exploring novel biotechnological applications of Burkholderia Lgt, potentially in combination with the natural product biosynthetic capacities of these bacteria , could lead to innovative technologies for agriculture, environmental remediation, or industrial processes.

  • Promoter Engineering Applications: Building on the successful identification of strong endogenous promoters in Burkholderia sp. , future research could optimize expression systems specifically for recombinant Lgt production, enabling more efficient structural and functional studies of this important enzyme.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.