Recombinant Burkholderia sp. Protease HtpX homolog (htpX)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Burkholderia sp. Protease HtpX Homolog (htpX)

The Recombinant Burkholderia sp. Protease HtpX homolog (htpX) is a recombinant protein derived from the Burkholderia species, specifically strain 383, which is also known as Burkholderia cepacia (strain ATCC 17760 / NCIB 9086 / R18194). This protein is a homolog of the HtpX protease, which plays a crucial role in various cellular processes, including protein quality control and stress response in bacteria.

Characteristics of Recombinant Burkholderia sp. Protease HtpX Homolog (htpX)

  • Protein Details: The recombinant HtpX homolog is a protein with a length of 285 amino acids. Its amino acid sequence is well-documented, providing insights into its structure and potential functions .

  • Storage and Handling: The recombinant protein is typically stored in a Tris-based buffer with 50% glycerol at -20°C. It is recommended to avoid repeated freezing and thawing to maintain its stability .

  • Function: While specific functions of the HtpX homolog in Burkholderia are not extensively detailed, HtpX proteases generally contribute to membrane protein quality control, similar to their roles in other bacteria and archaea .

Research Findings and Applications

  • Protein Quality Control: HtpX proteases are known to participate in the degradation of misfolded or damaged membrane proteins, which is crucial for maintaining cellular homeostasis under stress conditions .

  • Stress Response: In bacteria, HtpX proteases often show increased expression during stress, suggesting their role in stress adaptation mechanisms .

  • ELISA Kits: Recombinant HtpX homologs are used in ELISA kits for research purposes, allowing scientists to study the protein's interactions and functions in more detail .

Table 1: Characteristics of Recombinant Burkholderia sp. Protease HtpX Homolog (htpX)

CharacteristicDescription
SpeciesBurkholderia sp. (strain 383)
Protein Length285 amino acids
Storage BufferTris-based buffer with 50% glycerol
Storage Conditions-20°C or -80°C
FunctionProtein quality control, stress response

Table 2: Comparison of HtpX Proteases Across Different Organisms

OrganismFunctionStress Response
BurkholderiaProtein quality controlIncreased expression under stress
H. volcaniiMembrane protein quality controlIncreased abundance during oxidative stress
Pyrococcus furiosusMembrane protein quality controlIncreased transcript levels under heat shock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will then prepare your order accordingly.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us. We will prioritize developing the specified tag if possible.
Synonyms
htpX; Bcep18194_A6475; Protease HtpX homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-285
Protein Length
full length protein
Species
Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Target Names
htpX
Target Protein Sequence
MFNWVKTAMLMAAITALFIVIGGMIGGSRGMTIALLFALGMNFFSYWFSDKMVLRMYNAQ EVDENTAPQFYRMVRELATRANLPMPRVYLINEDAPNAFATGRNPEHAAVAATTGILRVL SEREMRGVMAHELAHVKHRDILISTITATMAGAISAIANFAMFFGGRDENGRPANPIAGI AVALLAPIAGALIQMAISRAREFEADRGGAQISGDPQSLATALDKIHRYAAGIPFQAAEQ HPATAQMMIMNPLHGGGLQNLFSTHPATEERIARLMEMARTGRFD
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Burkholderia sp. Protease HtpX homolog and what is its molecular function?

Burkholderia sp. Protease HtpX homolog is an M48 family zinc metalloproteinase (EC 3.4.24.-) primarily localized to the cytoplasmic membrane . In bacterial systems, HtpX functions in the quality control of membrane proteins, recognizing and degrading misfolded or damaged membrane proteins to maintain cellular homeostasis . The protein is encoded by the htpX gene (Ordered Locus Name: Bcep18194_A6475 in Burkholderia sp. strain 383) and consists of 285 amino acids . While direct evidence from Burkholderia species is limited, studies on homologous proteins suggest HtpX plays a critical role in bacterial adaptation to stress conditions through its proteolytic activity against specific membrane protein substrates .

How does HtpX in Burkholderia compare with homologs in other bacterial species?

HtpX proteases are evolutionarily conserved across diverse bacterial species, though with species-specific adaptations. The E. coli HtpX, which has been more extensively characterized, functions as an M48 family zinc metalloproteinase involved in membrane protein quality control, particularly under stress conditions . The Burkholderia homolog likely maintains this core function while potentially exhibiting modifications in substrate specificity and regulatory mechanisms reflecting Burkholderia's unique environmental niches and pathogenic potential. Both proteins share key structural features including membrane integration and metalloprotease catalytic domains . Importantly, research systems developed for studying E. coli HtpX, such as in vivo protease activity assays, can be adapted to investigate Burkholderia HtpX function, facilitating comparative analyses across bacterial species .

What are the optimal conditions for working with recombinant Burkholderia sp. HtpX protease?

Optimal handling of recombinant Burkholderia sp. Protease HtpX requires specific conditions to maintain its structural integrity and enzymatic activity:

ParameterRecommended ConditionRationale
Storage temperature-20°C (short-term); -80°C (long-term)Prevents protein degradation and maintains activity
Buffer compositionTris-based buffer with 50% glycerolOptimized for protein stability
Working conditionStore aliquots at 4°C for up to one weekMinimizes freeze-thaw cycles that reduce activity
Freeze-thaw cyclesAvoid repeated freezing and thawingPrevents protein denaturation and activity loss
Expression systemFull-length protein (region 1-285)Ensures complete functional domains are present

These conditions are critical for maintaining the native conformation and catalytic activity of the protease during experimental procedures . When working with the protein, researchers should avoid detergents that might disrupt the native membrane protein structure unless specifically required for solubilization experiments.

How can researchers establish a reliable in vivo assay for measuring HtpX protease activity?

Establishing a reliable in vivo assay for HtpX activity requires a strategic approach similar to that developed for E. coli HtpX . The key components of such an assay include:

  • Construction of a model substrate: Design a reporter protein substrate with (a) a recognition/cleavage site for HtpX, (b) a detectable tag or fluorescent marker that changes upon cleavage, and (c) appropriate localization to ensure interaction with the membrane-bound HtpX .

  • Expression system setup: Co-express both HtpX (or HtpX variants) and the model substrate in the same cells under controlled conditions, with appropriate controls including catalytically inactive HtpX mutants .

  • Detection method: Implement a semiquantitative detection method such as western blotting, fluorescence measurement, or enzymatic activity that allows reliable measurement of substrate cleavage as a function of HtpX activity .

  • Validation: Confirm assay specificity by testing HtpX mutants with mutations in conserved catalytic regions, which should show differential protease activities correlating with the severity of the mutation .

This system enables detection of differential protease activities between wild-type HtpX and mutant variants, providing a valuable tool for structure-function analyses and for investigating HtpX homologs across bacterial species .

What methodologies can be used to identify physiological substrates of HtpX protease?

Identifying the physiological substrates of HtpX requires a multi-faceted approach combining several complementary methodologies:

  • Comparative proteomics: Compare membrane proteome profiles between wild-type and htpX-deficient Burkholderia strains to identify proteins that accumulate in the absence of HtpX, indicating potential substrates .

  • Co-immunoprecipitation studies: Adapt techniques similar to those used for BopE-Rab32 interaction studies , using epitope-tagged HtpX (preferably with catalytic site mutations to stabilize interactions) to pull down interacting proteins that represent potential substrates.

  • Substrate trapping: Generate catalytically inactive HtpX variants (through site-directed mutagenesis of catalytic residues) that can bind but not cleave substrates, followed by identification of trapped substrates via mass spectrometry .

  • In vivo degradation assays: Test candidate substrates by monitoring their turnover rates in wild-type versus htpX-deficient backgrounds, similar to approaches used for studying protein degradation dynamics.

  • Bioinformatic prediction: Analyze the Burkholderia membrane proteome for proteins containing sequence motifs similar to known HtpX substrates from other bacterial species.

These approaches would collectively provide a comprehensive view of the HtpX substrate landscape in Burkholderia species.

How does HtpX protease contribute to Burkholderia stress response mechanisms?

While direct evidence for HtpX's role in Burkholderia stress response is limited in the search results, its function can be inferred based on related proteases and general bacterial stress response mechanisms. As a membrane-integrated metalloprotease involved in protein quality control , HtpX likely plays a crucial role in maintaining membrane integrity under stress conditions that cause protein misfolding or damage.

Similar to DegP in Burkholderia, which confers resistance to heat and high-salt stressors , HtpX would function to degrade misfolded membrane proteins that accumulate during environmental stress. This proteolytic activity would prevent the toxic accumulation of damaged proteins in the membrane, maintaining cellular function under adverse conditions.

The importance of membrane protein quality control is particularly relevant for Burkholderia species that must adapt to diverse environments, from soil to host organisms. By maintaining membrane proteostasis under stress, HtpX would contribute to Burkholderia's remarkable environmental adaptability and pathogenic potential.

What is the relationship between HtpX and other proteases like DegP in Burkholderia species?

Bacterial proteostasis relies on interconnected networks of proteases with complementary yet distinct functions. In Burkholderia, DegP has been characterized as having dual protease and chaperone functions, contributing to stress resistance and biofilm formation . HtpX, as a membrane-integrated metalloprotease , likely functions within this broader proteostasis network:

  • Functional complementarity: While DegP has dual chaperone-protease functions and broader substrate specificity , HtpX likely specializes in the degradation of specific integral membrane proteins .

  • Stress response coordination: Both proteases are upregulated under stress conditions, with DegP expression elevated 15-fold in symbiotic cells compared to stationary-phase cultured cells . HtpX may show similar regulation patterns during specific membrane stresses.

  • Spatial compartmentalization: HtpX's membrane integration positions it to immediately access membrane proteins , while DegP may target more accessible periplasmic or peripherally associated membrane proteins.

  • Potential sequential processing: In some cases, one protease might initiate cleavage of a substrate that is then further processed by the other, creating a degradation cascade.

This functional network of proteases creates redundancy and specialization that allows Burkholderia to precisely control protein quality across different cellular compartments under varying environmental conditions.

How might HtpX function relate to Burkholderia virulence and host interactions?

While the search results don't directly address HtpX's role in Burkholderia virulence, its function as a membrane protein quality control protease suggests several potential contributions to pathogenesis:

  • Stress adaptation during infection: Similar to DegP, which is essential for Burkholderia persistence in symbiotic associations , HtpX likely helps Burkholderia adapt to host-derived stresses by maintaining membrane integrity under changing environmental conditions.

  • Membrane protein homeostasis: Proper functioning of virulence factors embedded in or associated with the bacterial membrane may depend on HtpX-mediated quality control, ensuring these factors remain functional during host colonization.

  • Biofilm contribution: DegP supports biofilm formation in Burkholderia , and as another stress-responsive protease, HtpX may similarly contribute to biofilm development—a key virulence factor for persistent infections.

  • Immune evasion: By helping maintain membrane integrity under stress, HtpX might contribute to Burkholderia's ability to withstand host immune responses, similar to how BopE helps B. pseudomallei evade the host Rab32-dependent defense pathway .

These potential roles make HtpX an interesting candidate for further investigation in the context of Burkholderia pathogenesis, particularly for species like B. pseudomallei that cause serious human infections.

How can site-directed mutagenesis be applied to study HtpX functional domains?

Site-directed mutagenesis represents a powerful approach for dissecting the functional domains of HtpX protease. Based on approaches used for other bacterial proteases, a systematic mutagenesis strategy would include:

  • Identification of catalytic residues: Based on sequence alignment with characterized M48 metalloproteases, predict key catalytic residues coordinating the zinc ion and involved in peptide bond hydrolysis .

  • Conservative versus non-conservative mutations: Generate both conservative substitutions (maintaining similar chemical properties) and non-conservative mutations to assess the specific requirements at each position.

  • Transmembrane domain alterations: Create mutations in predicted transmembrane domains to assess their role in membrane integration and substrate recognition.

  • Substrate binding pocket modifications: Target residues likely involved in substrate specificity to potentially alter the enzyme's substrate preference.

  • Activity assays: Test mutant variants using the in vivo protease activity assay system to correlate structural features with catalytic activity .

This approach mirrors successful strategies used for DegP, where a S248A missense mutation specifically affected protease activity while maintaining other protein functions . Similar approaches applied to HtpX would provide a detailed map of structure-function relationships within this important protease.

What is the potential of HtpX as a therapeutic target for Burkholderia infections?

HtpX represents an intriguing potential therapeutic target for Burkholderia infections, particularly for pathogens like B. pseudomallei that cause serious human disease . Several factors support its consideration as a drug target:

  • Essential function: If HtpX proves essential for Burkholderia survival or virulence under host conditions, similar to DegP's role in symbiotic persistence , inhibitors could effectively compromise bacterial viability or pathogenicity.

  • Metalloprotease targetability: As a zinc metalloprotease , HtpX contains a well-defined active site amenable to inhibition by small molecules, similar to successful therapeutic approaches targeting human metalloproteases.

  • Bacterial specificity: Differences between bacterial HtpX and human proteases could allow for selective targeting, reducing potential toxicity of inhibitors.

  • Potential synergy: HtpX inhibitors might sensitize Burkholderia to other antibiotics or host defense mechanisms by compromising membrane protein homeostasis.

Developing HtpX-targeted therapeutics would require:

  • Validation of its importance in pathogenic Burkholderia strains

  • Structural characterization of the active site

  • High-throughput screening for selective inhibitors

  • In vivo testing in infection models

This approach could yield novel therapeutic options for difficult-to-treat Burkholderia infections, addressing an important public health need.

How can systems biology approaches enhance understanding of HtpX function in Burkholderia?

Systems biology approaches offer powerful frameworks for understanding HtpX within the broader context of Burkholderia cellular networks:

  • Multi-omics integration: Combining transcriptomics, proteomics, and metabolomics data from wild-type and htpX-deficient strains under various conditions would reveal the systemic impact of HtpX activity on cellular physiology.

  • Protein-protein interaction network mapping: Using techniques similar to the co-immunoprecipitation methods employed for studying BopE-Rab32 interactions , researchers could identify HtpX interaction partners, including substrates, regulators, and other components of the membrane protein quality control system.

  • Comparative systems analysis: Examining HtpX function across multiple Burkholderia species and related bacteria would reveal conserved and species-specific aspects of its role in the proteostasis network.

  • Mathematical modeling: Developing computational models of the membrane protein quality control network could predict system-level responses to perturbations in HtpX activity and identify potential compensatory mechanisms.

  • In vivo imaging: Developing fluorescent reporters to visualize HtpX activity in real-time during infection or stress response would provide spatial and temporal information about its function.

These approaches would place HtpX in its proper cellular context, revealing how this single protease contributes to the remarkable adaptability and pathogenicity of Burkholderia species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.